Protein

MCA_00012_1

Length
164 amino acids


Gene name: HYR1

Description: glutathione peroxidase, peroxiredoxin

Browser: contigA:34280-34775+

RNA-seq: read pairs 23766, FPKM 1779.7, percentile rank 97.6% (100% = highest expression)

Protein function

Annotation:HYR1glutathione peroxidase, peroxiredoxin
KEGG:K00432gpx glutathione peroxidase [EC:1.11.1.9]
EGGNOG:0PN5PPGUG_01527glutathione peroxidase
SGD closest match:S000001476HYR1Peroxiredoxin HYR1
CGD closest match:CAL0000196844orf19.86Glutathione peroxidase

Protein alignments

%idAln lengthE-value
MIA_04082_181.10%1645e-96MIA_04082_1
A0A0J9XK85_GEOCN78.75%1601e-89Glutathione peroxidase OS=Geotrichum candidum GN=BN980_GECA21s01484g PE=3 SV=1
A0A167DY32_9ASCO74.69%1622e-89Glutathione peroxidase OS=Sugiyamaella lignohabitans GN=GPX2 PE=3 SV=1
UniRef50_G8Y7C974.07%1623e-81Glutathione peroxidase n=21 Tax=cellular organisms TaxID=131567 RepID=G8Y7C9_PICSO
A0A1E4TKN8_9ASCO75.32%1585e-85Glutathione peroxidase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30496 PE=3 SV=1
GPX3_YEAST71.70%1594e-83Peroxiredoxin HYR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HYR1 PE=1 SV=1
Q6C7A8_YARLI71.70%1592e-81Glutathione peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E02310g PE=3 SV=1
A0A1E3PK09_9ASCO66.26%1637e-81Glutathione peroxidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82746 PE=3 SV=1
Q59WW7_CANAL70.44%1593e-80Glutathione peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.86 PE=3 SV=1
A0A060T2X0_BLAAD69.14%1624e-79Glutathione peroxidase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A04114g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0070

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 164

Detailed signature matches

    1. PR01011 (GLUTPROXDASE)
    2. PIRSF000303 (Glutat...)
    3. cd00340 (GSH_Peroxi...)
    4. PS51355 (GLUTATHION...)
    5. PF00255 (GSHPx)
    1. SSF52833 (Thioredox...)
    1. PS00460 (GLUTATHION...)
    1. PS00763 (GLUTATHION...)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. catalytic residues...
  2. dimer interface cd...

Protein sequence

>MCA_00012_1
MSAPSNFYDLKPLDKNGEPYPFSQLQGKVVLIVNVASKCGFTKQYAELEELNKKYGPQGLQILGFPCNQFAHQEPGTDEE
IAQFCQLNYGVTFPVLKKIDVNGDNADPVYVYLKNQKPGLLGFKGVKWNFEKFLVDKNGKVVERYASSKKPSKIAPEIEK
LLKA

GO term prediction

Biological Process

GO:0006979 response to oxidative stress
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004602 glutathione peroxidase activity

Cellular Component

None predicted.