Protein

MIA_04010_1

Length
246 amino acids


Browser: contig05:488816-489557+

Protein function

EGGNOG:0PFCXRPS440s ribosomal protein S4
SGD closest match:S000001246RPS4B40S ribosomal protein S4-B
CGD closest match:CAL0000191446RPS4240S ribosomal protein S4

Protein alignments

%idAln lengthE-value
MCA_02206_190.574%2447.71e-154MCA_02206_1
A0A0F7RST7_GEOCN84.519%2395.45e-14240S ribosomal protein S4 OS=Geotrichum candidum GN=BN980_GECA01s05554g PE=3 SV=1
A0A1E3PTE1_9ASCO82.988%2411.99e-14140S ribosomal protein S4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_39598 PE=3 SV=1
A0A060T8X7_BLAAD81.590%2394.46e-14040S ribosomal protein S4 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D14586g PE=3 SV=1
RS4_YARLI80.579%2426.13e-14040S ribosomal protein S4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS4 PE=2 SV=1
A0A167E7H2_9ASCO81.590%2391.42e-13940S ribosomal protein S4 OS=Sugiyamaella lignohabitans GN=RPS4A PE=3 SV=1
A0A1E4TLB0_9ASCO76.987%2392.42e-13240S ribosomal protein S4 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30676 PE=3 SV=1
RS4B_YEAST77.593%2414.95e-13140S ribosomal protein S4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4B PE=1 SV=1
UniRef50_P0CX3577.593%2411.18e-12740S ribosomal protein S4-A n=78 Tax=Opisthokonta TaxID=33154 RepID=RS4A_YEAST
A0A1D8PCI6_CANAL77.686%2429.41e-13040S ribosomal protein S4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS42 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2589
Predicted cleavage: 14

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 246

Detailed signature matches

    1. MF_00485 (Ribosomal...)
    2. PIRSF002116 (RPS4a_...)
    1. PF08071 (RS4NT)
    1. PF00900 (Ribosomal_S4e)
    1. PF00467 (KOW)
    1. PF16121 (40S_S4_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd06087 (KOW_RPS4)

Residue annotation

  1. RNA binding surfac...
  2. RNA binding site c...

Protein sequence

>MIA_04010_1
MLDKLSGTYAPRPSPGPHKLRESLPLVIFLRNRLKYALNGREVQSIVMQRLVKVDGKVRTDTTYPTGFMDVVSLEKTGEN
FRLIYDVKGRFAIHKISEEEAQYKLAKVKKVQLGKKGVPYIVTHDGRTIRYPDPLIKVNDTVKIDLATGKIVAHIKYASG
NVVMVTGGRNLGRVGTVTHLERHEGGFDIVHIKDALDNTFLTRLSNVFIIGEGSQPLISLPKAKGIRLTIAEERDERLAA
QQAASE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome