Protein

MCA_02206_1

Length
263 amino acids


Gene name: RPS4

Description: 40S ribosomal protein S4

Browser: contigB:585385-586624+

RNA-seq: read pairs 92952, FPKM 4350.5, percentile rank 99.3% (100% = highest expression)

Protein function

Annotation:RPS440S ribosomal protein S4
KEGG:K02987RP-S4e small subunit ribosomal protein S4e
EGGNOG:0PFCXRPS440s ribosomal protein S4
SGD closest match:S000001246RPS4B40S ribosomal protein S4-B
CGD closest match:CAL0000191446RPS4240S ribosomal protein S4

Protein alignments

%idAln lengthE-value
A0A0F7RST7_GEOCN84.94%2592e-16640S ribosomal protein S4 OS=Geotrichum candidum GN=BN980_GECA01s05554g PE=3 SV=1
A0A060T8X7_BLAAD84.17%2596e-16640S ribosomal protein S4 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D14586g PE=3 SV=1
A0A1E3PTE1_9ASCO85.49%2552e-16540S ribosomal protein S4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_39598 PE=3 SV=1
MIA_04010_190.57%2441e-164MIA_04010_1
RS4_YARLI82.69%2603e-16340S ribosomal protein S4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS4 PE=2 SV=1
A0A1E4TLB0_9ASCO79.54%2598e-15840S ribosomal protein S4 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30676 PE=3 SV=1
RS4B_YEAST79.07%2583e-15440S ribosomal protein S4-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS4B PE=1 SV=1
UniRef50_P0CX3579.07%2586e-15140S ribosomal protein S4-A n=78 Tax=Opisthokonta TaxID=33154 RepID=RS4A_YEAST
A0A167E7H2_9ASCO84.23%2415e-15340S ribosomal protein S4 OS=Sugiyamaella lignohabitans GN=RPS4A PE=3 SV=1
A0A1D8PCI6_CANAL78.38%2596e-15340S ribosomal protein S4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS42 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8424
Predicted cleavage: 32

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 263

Detailed signature matches

    1. MF_00485 (Ribosomal...)
    2. PIRSF002116 (RPS4a_...)
    1. PF08071 (RS4NT)
    1. SM00363 (s4_6)
    1. PF00900 (Ribosomal_S4e)
    1. PF00467 (KOW)
    1. PF16121 (40S_S4_C)
    1. PS00528 (RIBOSOMAL_S4E)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF55174 (Alpha-L R...)
  2. cd06087 (KOW_RPS4)

Residue annotation

  1. RNA binding surfac...
  2. RNA binding site c...

Protein sequence

>MCA_02206_1
MARGQKKHLKRLAAPSHWMLDKLSGTYAPRPSPGPHKLRESLPLIIFLRNRLKYALNGREAQAIVMQRLVKVDGKVRTDV
TYPTGFMDVVSLDKTGDNFRLIYDVKGRFAIHKISEEEAQYKLAKVKKVQLGKKGIPYLVTHDGRTIRYPDPLIKVNDTV
KIDLSTGKITSFIKFGHGNVVMVTGGRNLGRVGVITHLERHEGGFDIVHIKDALDNTFLTRLSNVFIIGEGSQPLISLPK
AKGIKLTIAEERDQRLAEAEEAD

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome