Protein

MIA_03962_1

Length
480 amino acids

Browser: contig05:362957-364400-

Protein function

EGGNOG:0PI9QTRM5Specifically methylates the N1 position of guanosine-37 in various cytoplasmic and mitochondrial tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first step in the biosynthesis of wybutosine (yW), a modified base adjacent to the anticodon of tRNAs and required for accurate decoding (By similarity)
SGD closest match:S000001112TRM5tRNA (guanine(37)-N1)-methyltransferase
CGD closest match:CAL0000174739TRM5tRNA (guanine(37)-N1)-methyltransferase

Protein alignments

%idAln lengthE-value
MCA_02226_175.427%4680.0MCA_02226_1
A0A0J9XIY2_GEOCN68.008%4720.0tRNA (guanine(37)-N1)-methyltransferase OS=Geotrichum candidum GN=TRM5 PE=3 SV=1
UniRef50_A0A0J9XIY268.008%4720.0tRNA (guanine(37)-N1)-methyltransferase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIY2_GEOCN
A0A060TD02_BLAAD55.066%4542.61e-175tRNA (guanine(37)-N1)-methyltransferase OS=Blastobotrys adeninivorans GN=TRM5 PE=3 SV=1
A0A167CUU4_9ASCO53.390%4721.34e-175tRNA (guanine(37)-N1)-methyltransferase OS=Sugiyamaella lignohabitans GN=TRM5 PE=3 SV=1
A0A1E3PIJ1_9ASCO49.451%4551.57e-151tRNA (guanine(37)-N1)-methyltransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=TRM5 PE=3 SV=1
TRM5_CANAL45.887%4629.18e-136tRNA (guanine(37)-N1)-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM5 PE=3 SV=2
TRM5_YEAST45.625%4807.19e-133tRNA (guanine(37)-N1)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM5 PE=1 SV=1
TRM5_YARLI43.238%4888.87e-124tRNA (guanine(37)-N1)-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRM5 PE=3 SV=1
A0A1E4TF95_9ASCO46.171%4447.31e-125Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13050 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4693

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 480

Detailed signature matches

  1. Family IPR025792
    tRNA (guanine(37)-N(1))-methyltransferase, eukaryotic
    1. MF_03152 (TRM5)
  2. Domain IPR029063
    S-adenosyl-L-methionine-dependent methyltransferase
    1. SSF53335 (S-adenosy...)
  3. Domain IPR030382
    SAM-dependent methyltransferase TRM5/TYW2-type
    1. PF02475 (Met_10)
    2. PS51684 (SAM_MT_TRM...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.30...
  2. G3DSA:3.40.50...

Protein sequence

>MIA_03962_1
MASAPVAKPPIKNYHHSTRTERFLPPVDRTMTVLDKSFFHKEIPLVAVKLQNPAYISNFARTYERFILKQHGVGHVVFLD
SKENSGPKGILLAEQYTDATETEKELVLELSDILKQTEITFVPYRLQLTYDFWKAEEILAAILPESLLDEIPVGFTVVGH
VAHLNIRDQYLPYKYIIGQVVLDKNPRVRTVVNKLDAIDTVFRTFEMEVLAGERDFMVEQSESNCRFRFDFSKVYWNSRL
HTEHDRLIRKFHRGQAVCDVFAGVGPFAVPAGKKHVLAFASDLNPESYKYLVSNIELNKVGAFVKPFCEDARTFIRDGVT
ALLDFQKETPSIVVPPKGRVSRSKPEKNPQPEAITVPKYYSHYVMNLPDTATEFLDSFIGLYNNPEIRESAFGSTDPRDV
ILPTIHVHCFHKHDPHVPEPSEAEVFKDLKARVSTKLNYEMKDDELEVHSVRKVAPTKTMYCLSFKLPLEVALKEPVIIE

GO term prediction

Biological Process

GO:0030488 tRNA methylation

Molecular Function

GO:0009019 tRNA (guanine-N1-)-methyltransferase activity

Cellular Component

None predicted.