Protein

MCA_02226_1

Length
475 amino acids

Gene name: TRM5

Description: tRNA (guanine(37)-N1)-methyltransferase

Browser: contigB:656330-657758+

RNA-seq: read pairs 549, FPKM 14.3, percentile rank 32.8% (100% = highest expression)

Protein function

Annotation:TRM5tRNA (guanine(37)-N1)-methyltransferase
KEGG:K15429TRM5 tRNA (guanine37-N1)-methyltransferase [EC:2.1.1.228]
EGGNOG:0PI9QTRM5Specifically methylates the N1 position of guanosine-37 in various cytoplasmic and mitochondrial tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first step in the biosynthesis of wybutosine (yW), a modified base adjacent to the anticodon of tRNAs and required for accurate decoding (By similarity)
SGD closest match:S000001112TRM5tRNA (guanine(37)-N1)-methyltransferase
CGD closest match:CAL0000174739TRM5tRNA (guanine(37)-N1)-methyltransferase

Protein alignments

%idAln lengthE-value
MIA_03962_175.43%4680.0MIA_03962_1
A0A0J9XIY2_GEOCN67.84%4820.0tRNA (guanine(37)-N1)-methyltransferase OS=Geotrichum candidum GN=TRM5 PE=3 SV=1
UniRef50_A0A0J9XIY267.84%4820.0tRNA (guanine(37)-N1)-methyltransferase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIY2_GEOCN
A0A167CUU4_9ASCO57.11%4572e-175tRNA (guanine(37)-N1)-methyltransferase OS=Sugiyamaella lignohabitans GN=TRM5 PE=3 SV=1
A0A060TD02_BLAAD53.50%4712e-164tRNA (guanine(37)-N1)-methyltransferase OS=Blastobotrys adeninivorans GN=TRM5 PE=3 SV=1
A0A1E3PIJ1_9ASCO49.89%4592e-150tRNA (guanine(37)-N1)-methyltransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=TRM5 PE=3 SV=1
TRM5_CANAL47.46%4721e-130tRNA (guanine(37)-N1)-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM5 PE=3 SV=2
TRM5_YEAST46.97%4794e-130tRNA (guanine(37)-N1)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM5 PE=1 SV=1
TRM5_YARLI43.12%4873e-121tRNA (guanine(37)-N1)-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRM5 PE=3 SV=1
A0A1E4TF95_9ASCO44.04%4455e-115Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13050 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7338

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 475

Detailed signature matches

  1. Family IPR025792
    tRNA (guanine(37)-N(1))-methyltransferase, eukaryotic
    1. MF_03152 (TRM5)
  2. Domain IPR029063
    S-adenosyl-L-methionine-dependent methyltransferase
    1. SSF53335 (S-adenosy...)
  3. Domain IPR030382
    SAM-dependent methyltransferase TRM5/TYW2-type
    1. PF02475 (Met_10)
    2. PS51684 (SAM_MT_TRM...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.30...
  2. G3DSA:3.40.50...

Protein sequence

>MCA_02226_1
MTSKSTYHHSTRTPMFLPPVDRSMKVLSKSFFHKEIPLVAVKLGNPAFIAKFSKTYERFILKQHGIGHVVFLTPLEESNE
TKAPPVKGILLAERFNSVEKAQKELTPEFTDVLKETTIDFLPYTLTLDYDFWKAEEILSAILPEDLLDEIPVGFTIVGHV
AHLNIRDRYLPFKNIIGQVVLDKNPKIKTVVNKLDSIDTVFRTFDMEVLAGENNFMVEQSESGCRFRFDFSKVYWNSRLH
TEHDRLIRKFSKGDAVCDVFAGVGPFAVPAGKKGVIAFASDLNPESHKYLVENIKLNKVEKFVKPFCEDARTFIVDGVRA
LLDFANENPVIEVPAKGRVSRSNPAKNPPPEVISVPKYYKHYVMNLPDTATEFLDSFIGLYKDKDLRTKIFGSTEAKDIV
LPMIHVHCFHKHPPHVPEPTEEEVTEALRRRISDKLNHEMKAEELYIHNVRKVAPTKVMYCISFKLPLEVAVKEN

GO term prediction

Biological Process

GO:0030488 tRNA methylation

Molecular Function

GO:0009019 tRNA (guanine-N1-)-methyltransferase activity

Cellular Component

None predicted.