Protein

MIA_03955_1

Length
130 amino acids

Browser: contig05:354760-355153-

Protein function

EGGNOG:0PNSSRPS2240s ribosomal protein s22
SGD closest match:S000003726RPS22A40S ribosomal protein S22-A

Protein alignments

%idAln lengthE-value
MCA_03940_188.462%1301.18e-86MCA_03940_1
Q6CA56_YARLI84.615%1302.19e-85YALI0D05731p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D05731g PE=3 SV=1
A0A1E3PDF3_9ASCO85.385%1303.51e-84Ribosomal protein S22B OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47856 PE=3 SV=1
A0A0J9XKI0_GEOCN85.385%1303.62e-83Similar to Saccharomyces cerevisiae YJL190C RPS22A Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA24s01176g PE=3 SV=1
RS22B_CANAL83.077%1302.53e-8340S ribosomal protein S22-B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS22B PE=3 SV=1
RS22A_YEAST83.077%1304.40e-8340S ribosomal protein S22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22A PE=1 SV=2
UniRef50_P0C0W183.077%1301.05e-7940S ribosomal protein S22-A n=183 Tax=Eukaryota TaxID=2759 RepID=RS22A_YEAST
A0A060SZP7_BLAAD83.077%1304.00e-82ARAD1C02310p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C02310g PE=3 SV=1
A0A1E4TIY8_9ASCO80.315%1272.61e-72Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_283 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1249

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR000630
    Ribosomal protein S8
    1. MF_01302_A (Ribosom...)
    2. PS00053 (RIBOSOMAL_S8)
    3. PF00410 (Ribosomal_S8)
    4. SSF56047 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.13...
  2. G3DSA:3.30.14...

Protein sequence

>MIA_03955_1
MTRASVLADALNAIYNAEKAGKRQVLIRPSSKVIIKFLTVMQAHGYIGEFEYVDDHRAGKIVVQLNGRLNKCGVISPRFN
VRIDEIEQWVSNLLPARQFGFIVLTTSAGIMDHEQARKKHVAGKMLGYFY

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome