Protein
MCA_03940_1
Length
130 amino acids
Gene name: RPS22
Description: 40s ribosomal protein s22
Browser: contigC:1567157-1567827-
RNA-seq: read pairs 18954, FPKM 1787.8, percentile rank 97.7% (100% = highest expression)
Protein function
Annotation: | RPS22 | 40s ribosomal protein s22 | |
---|---|---|---|
KEGG: | K02957 | RP-S15Ae | small subunit ribosomal protein S15Ae |
EGGNOG: | 0PNSS | RPS22 | 40s ribosomal protein s22 |
SGD closest match: | S000003726 | RPS22A | 40S ribosomal protein S22-A |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A1E3PDF3_9ASCO | 89.23% | 130 | 2e-87 | Ribosomal protein S22B OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47856 PE=3 SV=1 |
RS22A_YEAST | 87.69% | 130 | 9e-86 | 40S ribosomal protein S22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22A PE=1 SV=2 |
UniRef50_P0C0W1 | 87.69% | 130 | 2e-82 | 40S ribosomal protein S22-A n=183 Tax=Eukaryota TaxID=2759 RepID=RS22A_YEAST |
MIA_03955_1 | 88.46% | 130 | 5e-85 | MIA_03955_1 |
A0A060SZP7_BLAAD | 87.69% | 130 | 6e-85 | ARAD1C02310p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C02310g PE=3 SV=1 |
RS22B_CANAL | 85.38% | 130 | 9e-83 | 40S ribosomal protein S22-B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS22B PE=3 SV=1 |
A0A0J9XKI0_GEOCN | 86.15% | 130 | 5e-82 | Similar to Saccharomyces cerevisiae YJL190C RPS22A Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA24s01176g PE=3 SV=1 |
Q6CA56_YARLI | 84.62% | 130 | 3e-82 | YALI0D05731p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D05731g PE=3 SV=1 |
A0A1E4TIY8_9ASCO | 82.68% | 127 | 2e-72 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_283 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2443
Protein family membership
- Ribosomal protein S8 (IPR000630)
Domains and repeats
None predicted.
Detailed signature matches
-
-
MF_01302_A (Ribosom...)
-
PS00053 (RIBOSOMAL_S8)
-
PF00410 (Ribosomal_S8)
-
SSF56047 (Ribosomal...)
-

Unintegrated signatures
Protein sequence
>MCA_03940_1 MTRASVLADALNAINNAEKSGKRQVLIRPSSKVIIKFLQVMQKHGYIGDFEYVDDHRAGKIVVQLNGRINKCAVISPRFN VRIGDIEQWITNLLPARQFGFIILTTSAGIMDHEEARRKHVAGKILGYFY
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome