Protein

MCA_03940_1

Length
130 amino acids

Gene name: RPS22

Description: 40s ribosomal protein s22

Browser: contigC:1567157-1567827-

RNA-seq: read pairs 18954, FPKM 1787.8, percentile rank 97.7% (100% = highest expression)

Protein function

Annotation:RPS2240s ribosomal protein s22
KEGG:K02957RP-S15Ae small subunit ribosomal protein S15Ae
EGGNOG:0PNSSRPS2240s ribosomal protein s22
SGD closest match:S000003726RPS22A40S ribosomal protein S22-A

Protein alignments

%idAln lengthE-value
A0A1E3PDF3_9ASCO89.23%1302e-87Ribosomal protein S22B OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47856 PE=3 SV=1
RS22A_YEAST87.69%1309e-8640S ribosomal protein S22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22A PE=1 SV=2
UniRef50_P0C0W187.69%1302e-8240S ribosomal protein S22-A n=183 Tax=Eukaryota TaxID=2759 RepID=RS22A_YEAST
MIA_03955_188.46%1305e-85MIA_03955_1
A0A060SZP7_BLAAD87.69%1306e-85ARAD1C02310p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C02310g PE=3 SV=1
RS22B_CANAL85.38%1309e-8340S ribosomal protein S22-B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS22B PE=3 SV=1
A0A0J9XKI0_GEOCN86.15%1305e-82Similar to Saccharomyces cerevisiae YJL190C RPS22A Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA24s01176g PE=3 SV=1
Q6CA56_YARLI84.62%1303e-82YALI0D05731p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D05731g PE=3 SV=1
A0A1E4TIY8_9ASCO82.68%1272e-72Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_283 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2443

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR000630
    Ribosomal protein S8
    1. MF_01302_A (Ribosom...)
    2. PS00053 (RIBOSOMAL_S8)
    3. PF00410 (Ribosomal_S8)
    4. SSF56047 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.13...
  2. G3DSA:3.30.14...

Protein sequence

>MCA_03940_1
MTRASVLADALNAINNAEKSGKRQVLIRPSSKVIIKFLQVMQKHGYIGDFEYVDDHRAGKIVVQLNGRINKCAVISPRFN
VRIGDIEQWITNLLPARQFGFIILTTSAGIMDHEEARRKHVAGKILGYFY

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome