Protein

MIA_03912_1

Length
209 amino acids


Browser: contig05:247348-247978-

Protein function

EGGNOG:0PKXUERV25Constituent of COPII-coated endoplasmic reticulum- derived transport vesicles. Required for efficient transport of a subset of secretory proteins to the Golgi. Facilitates retrograde transport from the Golgi to the endoplasmic reticulum (By similarity)
SGD closest match:S000004473ERV25Endoplasmic reticulum vesicle protein 25
CGD closest match:CAL0000183368ERV25Endoplasmic reticulum vesicle protein 25

Protein alignments

%idAln lengthE-value
MCA_03427_178.87%2132e-105MCA_03427_1
A0A0J9X8M6_GEOCN74.11%1974e-91Similar to Saccharomyces cerevisiae YML012W ERV25 Protein that forms a heterotrimeric complex with Erp1,Erp2p, and Emp24, member of the p24 family OS=Geotrichum candidum GN=BN980_GECA05s04333g PE=3 SV=1
A0A167DLE6_9ASCO61.32%2128e-71Erv25p OS=Sugiyamaella lignohabitans GN=ERV25 PE=3 SV=1
A0A1E3PQH7_9ASCO61.32%2122e-68Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_69289 PE=3 SV=1
A0A060SWI8_BLAAD61.43%2105e-63ARAD1A01804p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A01804g PE=3 SV=1
TMEDA_YEAST54.93%2131e-60Endoplasmic reticulum vesicle protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV25 PE=1 SV=1
UniRef50_P5483754.93%2133e-57Endoplasmic reticulum vesicle protein 25 n=77 Tax=Saccharomycetales TaxID=4892 RepID=TMEDA_YEAST
TMEDA_YARLI51.17%2133e-58Endoplasmic reticulum vesicle protein 25 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERV25 PE=3 SV=1
TMEDA_CANAL50.70%2151e-55Endoplasmic reticulum vesicle protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERV25 PE=3 SV=1
A0A1E4TE46_9ASCO49.76%2114e-52Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31119 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1612

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 209

Detailed signature matches

    1. PF01105 (EMP24_GP25L)
    2. SM01190 (EMP24_GP25L_2)
    3. PS50866 (GOLD)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_03912_1
MRVFQLLLTFICAFLPIVSALKFQVEAKQQGFPPRCIRDFIQKGKMVVVKVTSSGQRGDGQTLNLHIHDNKGNEYGRKKD
VAGDVRLAFTAHDDASIDICFENIGQEPKRRDIELNVEIGSQARDWNQVQAAEKLKPTELELRRIEELTDEVQRELEYLK
IRETRLRDTNESTNRRVKFFSVGVVTSLVSLGLWQTIYLRSYFKSKHII

GO term prediction

Biological Process

GO:0006810 transport

Molecular Function

None predicted.

Cellular Component

GO:0016021 integral component of membrane