Protein

MCA_03427_1

Length
213 amino acids


Gene name: ERV25

Description: Endoplasmic reticulum vesicle protein 25

Browser: contigB:4400396-4401100+

RNA-seq: read pairs 3885, FPKM 224.3, percentile rank 89.3% (100% = highest expression)

Protein function

Annotation:ERV25Endoplasmic reticulum vesicle protein 25
KEGG:K20352TMED10 p24 family protein delta-1
EGGNOG:0PKXUERV25Constituent of COPII-coated endoplasmic reticulum- derived transport vesicles. Required for efficient transport of a subset of secretory proteins to the Golgi. Facilitates retrograde transport from the Golgi to the endoplasmic reticulum (By similarity)
SGD closest match:S000004473ERV25Endoplasmic reticulum vesicle protein 25
CGD closest match:CAL0000183368ERV25Endoplasmic reticulum vesicle protein 25

Protein alignments

%idAln lengthE-value
MIA_03912_178.87%2136e-103MIA_03912_1
A0A0J9X8M6_GEOCN72.90%2141e-90Similar to Saccharomyces cerevisiae YML012W ERV25 Protein that forms a heterotrimeric complex with Erp1,Erp2p, and Emp24, member of the p24 family OS=Geotrichum candidum GN=BN980_GECA05s04333g PE=3 SV=1
A0A167DLE6_9ASCO66.83%2084e-77Erv25p OS=Sugiyamaella lignohabitans GN=ERV25 PE=3 SV=1
A0A1E3PQH7_9ASCO65.40%2114e-74Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_69289 PE=3 SV=1
A0A060SWI8_BLAAD66.51%2092e-68ARAD1A01804p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A01804g PE=3 SV=1
TMEDA_YARLI53.52%2132e-64Endoplasmic reticulum vesicle protein 25 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERV25 PE=3 SV=1
UniRef50_Q6C50353.52%2136e-61Endoplasmic reticulum vesicle protein 25 n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=TMEDA_YARLI
TMEDA_YEAST55.61%2143e-59Endoplasmic reticulum vesicle protein 25 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV25 PE=1 SV=1
TMEDA_CANAL50.93%2167e-57Endoplasmic reticulum vesicle protein 25 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERV25 PE=3 SV=1
A0A1E4TE46_9ASCO50.23%2172e-51Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31119 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0301

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 200 213

Detailed signature matches

    1. PF01105 (EMP24_GP25L)
    2. SM01190 (EMP24_GP25L_2)
    3. PS50866 (GOLD)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_03427_1
MKTFQFLFVLLLSIIPLVSAVKFSVEAKPKGSPPRCIRDFVTKGKMVVVKVTSSGQRGDGQVLNLHIYDNKGNEYGRKKD
IAGDVRLAFTAHDDAAFDVCFENIGDNTYNNARKRDIELNVEIGAQARDWNQVQAAEKLKPTELELRRIEELTDEVQREL
EYLKIREIRLRDTNESTNRRVKYFSIGVIVSLVSLGVWQIVYLRSYFRSKHIL

GO term prediction

Biological Process

GO:0006810 transport

Molecular Function

None predicted.

Cellular Component

GO:0016021 integral component of membrane