Protein
MIA_03820_1
Length
93 amino acids
Browser: contig04:2243175-2243611-
Protein function
EGGNOG: | 0PSKT | MDM35 | mitochondrial distribution and morphology protein |
---|---|---|---|
SGD closest match: | S000007243 | MDM35 | Mitochondrial distribution and morphology protein 35 |
CGD closest match: | CAL0000199336 | orf19.4676 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_05083_1 | 85.714% | 84 | 9.92e-52 | MCA_05083_1 |
A0A060TDU5_BLAAD | 80.263% | 76 | 1.75e-44 | ARAD1D46838p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46838g PE=4 SV=1 |
A0A0J9XJQ5_GEOCN | 72.222% | 90 | 4.67e-43 | Similar to Saccharomyces cerevisiae YKL053C-A MDM35 Mitochondrial intermembrane space protein OS=Geotrichum candidum GN=BN980_GECA23s00604g PE=4 SV=1 |
UniRef50_A0A0J9XJQ5 | 72.222% | 90 | 9.56e-40 | Similar to Saccharomyces cerevisiae YKL053C-A MDM35 Mitochondrial intermembrane space protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJQ5_GEOCN |
A0A1E3PF78_9ASCO | 65.476% | 84 | 1.09e-38 | UPF0203-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52853 PE=4 SV=1 |
B5RSM8_YARLI | 68.056% | 72 | 1.84e-34 | YALI0F31548p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F31548g PE=4 SV=1 |
A0A1E4TML7_9ASCO | 66.667% | 75 | 1.04e-33 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_49263 PE=4 SV=1 |
MDM35_YEAST | 65.333% | 75 | 1.65e-33 | Mitochondrial distribution and morphology protein 35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM35 PE=1 SV=3 |
Q5AMH0_CANAL | 56.962% | 79 | 1.76e-29 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4676 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1023
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
PS51808 (CHCH)
-
mobidb-lite (disord...)
Protein sequence
>MIA_03820_1 MSASFAPECTNAKKAYDNCFNEWYSEKFLKAKSVTNECEDTWREYESCIHTALEKKGIKTMLNDARKDAPFEKGGVSQAH ETSSDNSSVETTK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.