Protein
MCA_05083_1
Length
87 amino acids
Gene name: MDM35
Description: Mitochondrial distribution and morphology protein 35; Saccharomyces cerevisiae homologue resides in intermembrane space; forms complex with Ups2p that transfers phosphatidylserine from outer membrane to inner membrane for phosphatidylethanolamine synthesis;
Browser: contigD:327735-328257-
RNA-seq: read pairs 1949, FPKM 273.7, percentile rank 91.2% (100% = highest expression)
Protein function
| Annotation: | MDM35 | Mitochondrial distribution and morphology protein 35; Saccharomyces cerevisiae homologue resides in intermembrane space; forms complex with Ups2p that transfers phosphatidylserine from outer membrane to inner membrane for phosphatidylethanolamine synthesis; | |
|---|---|---|---|
| KEGG: | K17968 | TRIAP1 | TRIAP1/MDM35 family protein |
| EGGNOG: | 0PSKT | MDM35 | mitochondrial distribution and morphology protein |
| SGD closest match: | S000007243 | MDM35 | Mitochondrial distribution and morphology protein 35 |
| CGD closest match: | CAL0000199336 | orf19.4676 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03820_1 | 85.71% | 84 | 2e-50 | MIA_03820_1 |
| A0A0J9XJQ5_GEOCN | 77.91% | 86 | 2e-42 | Similar to Saccharomyces cerevisiae YKL053C-A MDM35 Mitochondrial intermembrane space protein OS=Geotrichum candidum GN=BN980_GECA23s00604g PE=4 SV=1 |
| UniRef50_A0A0J9XJQ5 | 77.91% | 86 | 3e-39 | Similar to Saccharomyces cerevisiae YKL053C-A MDM35 Mitochondrial intermembrane space protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJQ5_GEOCN |
| A0A060TDU5_BLAAD | 79.49% | 78 | 3e-42 | ARAD1D46838p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D46838g PE=4 SV=1 |
| A0A1E3PF78_9ASCO | 68.00% | 75 | 8e-35 | UPF0203-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52853 PE=4 SV=1 |
| MDM35_YEAST | 68.42% | 76 | 2e-33 | Mitochondrial distribution and morphology protein 35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM35 PE=1 SV=3 |
| B5RSM8_YARLI | 67.12% | 73 | 2e-32 | YALI0F31548p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F31548g PE=4 SV=1 |
| A0A1E4TML7_9ASCO | 64.47% | 76 | 2e-31 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_49263 PE=4 SV=1 |
| Q5AMH0_CANAL | 60.24% | 83 | 1e-29 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4676 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0758
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
PS51808 (CHCH)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05083_1 MSASFAPECTDAKKAYDNCFNEWYSEKFLKAKSVTNECEETWREYETCIYQALEKKGIKTMLSEARKDAPFEKGGRSESH EGESAQK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.