Protein

MIA_03787_1

Length
58 amino acids

Browser: contig04:2163291-2163554+

Protein function

EGGNOG:0PS9BFG05564.1NADH-ubiquinone oxidoreductase B12 subunit
CGD closest match:CAL0000191606orf19.4751.1Uncharacterized protein

Protein alignments

%idAln lengthE-value
A0A0J9XD68_GEOCN77.586%585.80e-29NB2M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA11s01638g PE=4 SV=1
MCA_03615_181.481%543.37e-28MCA_03615_1
UniRef50_A0A1B7YPK663.158%572.31e-18NADH-ubiquinone oxidoreductase B12 subunit n=28 Tax=leotiomyceta TaxID=716546 RepID=A0A1B7YPK6_COLHI
B5FVE5_YARLI69.492%596.52e-22YALI0D10274p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D10274g PE=4 SV=1
A0A060TEN9_BLAAD61.017%591.59e-20ARAD1D16302p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D16302g PE=4 SV=1
A0A1D8PEJ9_CANAL64.583%482.52e-17Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4751.1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0748

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR012576
    NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3
    1. PF08122 (NDUF_B12)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_03787_1
MAEPLKDPWARREAWRTQGQFTRFNRFKGALPGFGIATVAFIAFNIGEYFFLPKDSHH

GO term prediction

Biological Process

GO:0022900 electron transport chain

Molecular Function

None predicted.

Cellular Component

GO:0005739 mitochondrion
GO:0005747 mitochondrial respiratory chain complex I