Protein
MCA_03615_1
Length
57 amino acids
Description: Putative NADH dehydrogenase (ubiquinone) subunit
Browser: contigC:550137-550385+
RNA-seq: read pairs 7433, FPKM 1583.5, percentile rank 97.4% (100% = highest expression)
Protein function
| Annotation: | Putative NADH dehydrogenase (ubiquinone) subunit | ||
|---|---|---|---|
| KEGG: | K03959 | NDUFB3 | NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 3 |
| EGGNOG: | 0PS9B | FG05564.1 | NADH-ubiquinone oxidoreductase B12 subunit |
| CGD closest match: | CAL0000191606 | orf19.4751.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03787_1 | 81.48% | 54 | 5e-27 | MIA_03787_1 |
| A0A0J9XD68_GEOCN | 73.58% | 53 | 7e-25 | NB2M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA11s01638g PE=4 SV=1 |
| B5FVE5_YARLI | 65.45% | 55 | 2e-20 | YALI0D10274p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D10274g PE=4 SV=1 |
| UniRef50_A0A1E1MN90 | 64.15% | 53 | 1e-16 | Related to NADH-ubiquinone oxidoreductase B12 subunit n=3 Tax=Rhynchosporium TaxID=38037 RepID=A0A1E1MN90_RHYSE |
| A0A060TEN9_BLAAD | 55.56% | 54 | 2e-18 | ARAD1D16302p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D16302g PE=4 SV=1 |
| A0A1D8PEJ9_CANAL | 56.25% | 48 | 3e-14 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4751.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0132
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_03615_1 MALKDPWAKREAWRFEGPMTRVNRFKGALPGFGIAVVAFTAFNIAEYFFLPKDSGHH
GO term prediction
Biological Process
GO:0022900 electron transport chain
Molecular Function
None predicted.
Cellular Component
GO:0005739 mitochondrion
GO:0005747 mitochondrial respiratory chain complex I