Protein

MIA_03742_1

Length
566 amino acids

Browser: contig04:2033019-2034765+

Protein function

EGGNOG:0PJCWYNG2Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Involved in cell cycle progression and meiosis
SGD closest match:S000001132YNG2Chromatin modification-related protein YNG2
CGD closest match:CAL0000174600YNG2Chromatin modification-related protein YNG2

Protein alignments

%idAln lengthE-value
MCA_03304_161.078%1675.60e-59MCA_03304_1
A0A0J9XJB4_GEOCN70.732%1234.23e-55Chromatin modification-related protein OS=Geotrichum candidum GN=BN980_GECA24s00890g PE=3 SV=1
UniRef50_A0A0J9XJB470.732%1238.66e-52Chromatin modification-related protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJB4_GEOCN
A0A060TBQ3_BLAAD64.122%1318.86e-53Chromatin modification-related protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B10274g PE=3 SV=1
A0A1E3PG82_9ASCO61.538%1433.50e-52Chromatin modification-related protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_26999 PE=3 SV=1
YNG2_YARLI64.912%1144.68e-48Chromatin modification-related protein YNG2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YNG2 PE=3 SV=1
A0A167F864_9ASCO66.667%878.42e-35Chromatin modification-related protein OS=Sugiyamaella lignohabitans GN=YNG2 PE=3 SV=1
A0A1E4TJ02_9ASCO49.242%1323.95e-34Chromatin modification-related protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_75175 PE=3 SV=1
YNG2_CANAL47.287%1291.30e-31Chromatin modification-related protein YNG2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YNG2 PE=3 SV=2
YNG2_YEAST45.763%1181.64e-23Chromatin modification-related protein YNG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNG2 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0155

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 100 200 300 400 500 566

Detailed signature matches

  1. Domain IPR024610
    Inhibitor of growth protein, N-terminal histone-binding
    1. PF12998 (ING)
    2. SM01408 (ING_2)
  2. Domain IPR013083
    Zinc finger, RING/FYVE/PHD-type
    1. G3DSA:3.30.40.10
  3. Domain IPR011011
    Zinc finger, FYVE/PHD-type
    1. SSF57903 (FYVE/PHD ...)
  4. Domain IPR001965
    Zinc finger, PHD-type
    1. SM00249 (PHD_3)
  5. Domain IPR019787
    Zinc finger, PHD-finger
    1. PS50016 (ZF_PHD_2)
  6. SITE IPR019786
    Zinc finger, PHD-type, conserved site
    1. PS01359 (ZF_PHD_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd15505 (PHD_ING)
  2. mobidb-lite (disord...)

Residue annotation

  1. H3K4me3 binding si...
  2. Zn binding site cd...

Protein sequence

>MIA_03742_1
MKHEKEDAASVLEQYISDVGNLPGEIAHVLEEIREKDLKFYDTRKRIQQRDNQIHKFIRTHGSLAENPKEISAYPKIRAD
FEKARILQNEKCDLSITGLYLISKHLRRLMEKIELLERDGEIPPDPNPAAITDFTLSTPGAAVTSESNPLLYSMMAAAQA
GTAGTGLGMASIAQLGHGSAASGSAAATVAAQLHSHLIGGAAGHAASTSASASTTATTSTTARAGSTRATGSRQSRAGTA
AVANANAAGTAASGGHGASGPTSHRKHSSTGPNSRSSTPGSVQGANGAATAGSGVGNGSGAAGLAGELAGTAGTGATTKG
KGAAAVAAAAAAAGISGSATAAALNATNGASVSTSVGAGASSGASTRPTKRHKVGAGAGHKTGAGRKGANGSNSGSSSRN
STPAAEANGATGGSGAGSAGGAAGTKAGSRRGTNASEHTGGRAAASVSAAAAAAAAAAAAAAAEALEADEEVDSTSRSRS
RSREKEEEEEPAVEDAGVVVDGEDEVYCSCRQVSFGNMVACDNPTCPYEWFHWECVGLVETPQGTWYCPTCTKSMKEKDS
KKRTRG

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.