Protein

MIA_03723_1

Length
292 amino acids

Browser: contig04:1976422-1977301-

Protein function

EGGNOG:0PGKAFG09234.1NADH-ubiquinone oxidoreductase 304 kDa subunit
CGD closest match:CAL0000194133ALI1Ali1p

Protein alignments

%idAln lengthE-value
A0A0J9X493_GEOCN80.216%2783.25e-163NUGM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA02s07666g PE=3 SV=1
MCA_04823_177.580%2811.32e-160MCA_04823_1
A0A167DBT3_9ASCO77.291%2512.44e-147Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_999 PE=3 SV=1
A0A060T7P6_BLAAD74.231%2601.88e-144ARAD1C29282p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29282g PE=3 SV=1
F2Z6D7_YARLI65.909%2641.35e-132YALI0F02123p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F02123g PE=3 SV=1
A0A1D8PJ73_CANAL64.202%2572.94e-125Ali1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALI1 PE=3 SV=1
UniRef50_Q0067363.258%2647.05e-121Probable NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial n=73 Tax=Dikarya TaxID=451864 RepID=NDUS3_CANMA
A0A1E4TF63_9ASCO68.996%2292.52e-124Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_105673 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9877
Predicted cleavage: 40

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 292

Detailed signature matches

  1. Family IPR010218
    NADH dehydrogenase, subunit C
    1. TIGR01961
    2. MF_01357 (NDH1_NuoC)
  2. Domain IPR001268
    NADH:ubiquinone oxidoreductase, 30kDa subunit
    1. PF00329 (Complex1_3...)
    2. PD001581
  3. SITE IPR020396
    NADH:ubiquinone oxidoreductase, 30kDa subunit, conserved site
    1. PS00542 (COMPLEX1_30K)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF143243 (Nqo5-like)
  2. mobidb-lite (disord...)

Protein sequence

>MIA_03723_1
MALLRTAIGQSARLSVSRQVSRAAVMGVRPLSTSGGARLAPVQITPEGLPDLKSLPRQQQPKEIKAPIENPADKYLEHVE
DLHKYGKYLITALPKFIQKFSVWKDELTLFIPPTAVIPVLTFLKDHTSAQYKTVMDVTAVDFPSRTNRFEVVYNLLSVRF
NSRIRVKTYASETSAVPSIARIFEGTNWYERETYDMFGVFFEGHPDLRRILTDYGFEGHPLRKDFPVTGYTEVRYDEEKK
RVVYEPLEMTQAFRNFSVGATVWEPVGPGRDDRPESFKLPTPKPEPEAEEKK

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016651 oxidoreductase activity, acting on NAD(P)H

Cellular Component

None predicted.