Protein

MCA_04823_1

Length
294 amino acids


Gene name: ALI1

Description: 30 kDa subunit of NADH-ubiquinone oxidoreductase (respiratory complex I)

Browser: contigC:4176363-4177248+

RNA-seq: read pairs 17081, FPKM 715.4, percentile rank 95.6% (100% = highest expression)

Protein function

Annotation:ALI130 kDa subunit of NADH-ubiquinone oxidoreductase (respiratory complex I)
KEGG:K03936NDUFS3 NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:1.6.5.3 1.6.99.3]
EGGNOG:0PGKAFG09234.1NADH-ubiquinone oxidoreductase 304 kDa subunit
CGD closest match:CAL0000194133ALI1Ali1p

Protein alignments

%idAln lengthE-value
A0A0J9X493_GEOCN78.42%2781e-165NUGM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA02s07666g PE=3 SV=1
MIA_03723_177.89%2857e-162MIA_03723_1
A0A167DBT3_9ASCO78.17%2522e-148Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_999 PE=3 SV=1
A0A060T7P6_BLAAD78.74%2549e-146ARAD1C29282p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29282g PE=3 SV=1
F2Z6D7_YARLI69.88%2597e-134YALI0F02123p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F02123g PE=3 SV=1
UniRef50_Q0067364.42%2674e-125Probable NADH-ubiquinone oxidoreductase 30.4 kDa subunit, mitochondrial n=73 Tax=Dikarya TaxID=451864 RepID=NDUS3_CANMA
A0A1E4TF63_9ASCO69.83%2325e-127Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_105673 PE=3 SV=1
A0A1D8PJ73_CANAL63.81%2684e-124Ali1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALI1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9867
Predicted cleavage: 43

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 294

Detailed signature matches

    1. MF_01357 (NDH1_NuoC)
    1. PF00329 (Complex1_3...)
    1. PS00542 (COMPLEX1_30K)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF143243 (Nqo5-like)
  2. mobidb-lite (disord...)

Protein sequence

>MCA_04823_1
MSLLRSAITKGSRNCVRPMVNKVAPSAPVLLARTFTSSTTVQKPAQVTPEGLPDLKSLKRVDPGVLHAEIVNPADKYQEH
VEDLHKYGKYLITTLPKFIQKFSVWKDELTLFVAPSAIVPVMTFLKDHTSAQFKSVMDVTAADFPSRTNRFEVVYNLLSV
RFNSRIRVKTYASETSPVPSIARIFEGANWFERETYDMFGVFFEGHPDLRRILTDYGFEGHPLRKDFPIHGYTEVRYDEE
KKRVVYEPIEMTQAFRNFSAGSTVWEPVGPGRDDRPDSFKLPTPKPEPEEEEKK

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016651 oxidoreductase activity, acting on NAD(P)H

Cellular Component

None predicted.