Protein

MIA_03664_1

Length
435 amino acids

Browser: contig04:1828997-1830484+

Protein function

EGGNOG:0PKVGVMA13vacuolar ATP synthase subunit H
SGD closest match:S000006240VMA13V-type proton ATPase subunit H
CGD closest match:CAL0000198653VMA13H(+)-transporting V1 sector ATPase subunit H

Protein alignments

%idAln lengthE-value
MCA_03798_170.601%4490.0MCA_03798_1
A0A0J9XGG6_GEOCN61.111%4322.75e-173Similar to Saccharomyces cerevisiae YPR036W VMA13 Subunit H of the eight-subunit V1 peripheral membrane domain of the vacuolar H+-ATPase (V-ATPase) OS=Geotrichum candidum GN=BN980_GECA15s02012g PE=4 SV=1
A0A1E3PFK0_9ASCO47.045%4403.50e-133ATPase, V1 complex, subunit H OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_38165 PE=4 SV=1
A0A167FH48_9ASCO50.348%4314.58e-133H(+)-transporting V1 sector ATPase subunit H OS=Sugiyamaella lignohabitans GN=VMA13 PE=4 SV=1
UniRef50_A0A167FH4850.348%4311.26e-129H(+)-transporting V1 sector ATPase subunit H n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167FH48_9ASCO
A0A060T8V2_BLAAD49.373%3995.54e-118ARAD1D05742p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D05742g PE=4 SV=1
Q6C6K9_YARLI44.598%4359.50e-115YALI0E08617p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E08617g PE=4 SV=1
A0A1E4TCN3_9ASCO40.323%4345.62e-85Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_28633 PE=4 SV=1
VATH_YEAST36.071%2806.34e-52V-type proton ATPase subunit H OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA13 PE=1 SV=1
A0A1D8PSX0_CANAL32.898%4598.05e-43H(+)-transporting V1 sector ATPase subunit H OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VMA13 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1032

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 435

Detailed signature matches

  1. Family IPR004908
    ATPase, V1 complex, subunit H
    1. PIRSF032184 (V-ATP_...)
  2. Domain IPR016024
    Armadillo-type fold
    1. SSF48371 (ARM repeat)
  3. Domain IPR011989
    Armadillo-like helical
    1. G3DSA:1.25.10.10
  4. Domain IPR011987
    ATPase, V1 complex, subunit H, C-terminal
    1. PF11698 (V-ATPase_H_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.25.40...
  2. PF03224 (V-ATPase_H_N)

Protein sequence

>MIA_03664_1
MTVPVAPITYISSDFLDEIQKNILVRPIPWDGYVRAALLSNEDATLLKSIEKQPQVVEKKLEHVAQTFATLLHTISREDV
VKYLLALTVTLLETVPQFSGALLALSEKDASLPYEPFVKFLDKSQDIHLLAVKNLVILFSLKEAPAPYVSTTLTFITSKL
ATPADTNLQDIAVQSLGLLLQSKWYRGLFWTASAERIPPLLTILAGSKTNIQLQYHTLLALWLLSFERLPAKELVTKFDI
VPVYFDIIKNSVKEKTIRLAVALLVNAVTLAPKETVSSLLVNQGLTFIGTLSERKWADEELVADLETLKDTLQTAFDSMT
TFDEYKNELESKKLRWSPPHRSEGFWRENAEEFKAHDWKVLKALVDIIKSGPTDPVVAAVAASDINRVFSIFPEAVKVVE
RIGGKVAIMELMNHPSDEVRYEALKATQTLISNTL

GO term prediction

Biological Process

GO:0015991 ATP hydrolysis coupled proton transport

Molecular Function

GO:0005488 binding
GO:0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
GO:0046961 proton-transporting ATPase activity, rotational mechanism

Cellular Component

GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain