Protein
MIA_03649_1
Length
102 amino acids
Browser: contig04:1802585-1803002-
Protein function
EGGNOG: | 0PPM7 | FG01238.1 | 60S ribosomal protein L36 |
---|---|---|---|
SGD closest match: | S000006438 | RPL36B | 60S ribosomal protein L36-B |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_04438_1 | 89.216% | 102 | 1.00e-52 | MCA_04438_1 |
A0A0J9XGC8_GEOCN | 80.392% | 102 | 9.22e-43 | 60S ribosomal protein L36 OS=Geotrichum candidum GN=BN980_GECA14s03035g PE=3 SV=1 |
A0A1E3PL57_9ASCO | 73.267% | 101 | 9.35e-40 | 60S ribosomal protein L36 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46685 PE=3 SV=1 |
UniRef50_A0A0L1HRV3 | 67.000% | 100 | 9.62e-30 | 60S ribosomal protein L36 n=45 Tax=leotiomyceta TaxID=716546 RepID=A0A0L1HRV3_9PLEO |
B5FVF9_YARLI | 70.707% | 99 | 3.54e-35 | 60S ribosomal protein L36 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E30602g PE=3 SV=1 |
A0A060TFI8_BLAAD | 69.000% | 100 | 1.47e-34 | 60S ribosomal protein L36 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D23672g PE=3 SV=1 |
A0A1E4TGV8_9ASCO | 66.327% | 98 | 1.07e-32 | 60S ribosomal protein L36 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31797 PE=3 SV=1 |
RL36B_YEAST | 64.286% | 98 | 3.62e-30 | 60S ribosomal protein L36-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL36B PE=1 SV=3 |
A0A1D8PH21_CANAL | 65.625% | 96 | 1.19e-28 | 60S ribosomal protein L36 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL39 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8730
Predicted cleavage: 31
Protein family membership
- Ribosomal protein L36e (IPR000509)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_03649_1 MAAQKSGIAIGANKGHKVTPRTPAARFNRKATVSTKTAFVRDIISEVAGLAPYERRVIELIRNSQEKRARKLAKKKLGTH GRAKAKVEKMNQIIAESRRAAH
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome