Protein

MCA_04438_1

Length
102 amino acids

Gene name: RPL36B

Description: 60S ribosomal protein L36-B

Browser: contigC:3051050-3051439+

RNA-seq: read pairs 30892, FPKM 3705.9, percentile rank 99.0% (100% = highest expression)

Protein function

Annotation:RPL36B60S ribosomal protein L36-B
KEGG:K02920RP-L36e large subunit ribosomal protein L36e
EGGNOG:0PPM7FG01238.160S ribosomal protein L36
SGD closest match:S000006438RPL36B60S ribosomal protein L36-B

Protein alignments

%idAln lengthE-value
MIA_03649_189.22%1022e-51MIA_03649_1
A0A0J9XGC8_GEOCN81.37%1021e-4360S ribosomal protein L36 OS=Geotrichum candidum GN=BN980_GECA14s03035g PE=3 SV=1
A0A1E3PL57_9ASCO76.24%1011e-4160S ribosomal protein L36 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46685 PE=3 SV=1
UniRef50_A0A0L1HRV370.00%1004e-3060S ribosomal protein L36 n=45 Tax=leotiomyceta TaxID=716546 RepID=A0A0L1HRV3_9PLEO
A0A060TFI8_BLAAD72.00%1006e-3560S ribosomal protein L36 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D23672g PE=3 SV=1
B5FVF9_YARLI68.69%992e-3260S ribosomal protein L36 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E30602g PE=3 SV=1
A0A1E4TGV8_9ASCO67.35%984e-3160S ribosomal protein L36 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31797 PE=3 SV=1
RL36B_YEAST62.24%989e-2960S ribosomal protein L36-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL36B PE=1 SV=3
A0A1D8PH21_CANAL64.58%965e-2760S ribosomal protein L36 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL39 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8706
Predicted cleavage: 31

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR000509
    Ribosomal protein L36e
    1. PS01190 (RIBOSOMAL_...)
    2. PF01158 (Ribosomal_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_04438_1
MAAQKSGIAVGINKGHKVTPRTPAARFNRKKTPSTKTLFVRDIISEVAGLAPYERRVIELIRNSQEKRARKLAKKKLGTF
GRAKAKVEQMTKVIAETRRAAH

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome