Protein
MCA_04438_1
Length
102 amino acids
Gene name: RPL36B
Description: 60S ribosomal protein L36-B
Browser: contigC:3051050-3051439+
RNA-seq: read pairs 30892, FPKM 3705.9, percentile rank 99.0% (100% = highest expression)
Protein function
| Annotation: | RPL36B | 60S ribosomal protein L36-B | |
|---|---|---|---|
| KEGG: | K02920 | RP-L36e | large subunit ribosomal protein L36e |
| EGGNOG: | 0PPM7 | FG01238.1 | 60S ribosomal protein L36 |
| SGD closest match: | S000006438 | RPL36B | 60S ribosomal protein L36-B |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03649_1 | 89.22% | 102 | 2e-51 | MIA_03649_1 |
| A0A0J9XGC8_GEOCN | 81.37% | 102 | 1e-43 | 60S ribosomal protein L36 OS=Geotrichum candidum GN=BN980_GECA14s03035g PE=3 SV=1 |
| A0A1E3PL57_9ASCO | 76.24% | 101 | 1e-41 | 60S ribosomal protein L36 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46685 PE=3 SV=1 |
| UniRef50_A0A0L1HRV3 | 70.00% | 100 | 4e-30 | 60S ribosomal protein L36 n=45 Tax=leotiomyceta TaxID=716546 RepID=A0A0L1HRV3_9PLEO |
| A0A060TFI8_BLAAD | 72.00% | 100 | 6e-35 | 60S ribosomal protein L36 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D23672g PE=3 SV=1 |
| B5FVF9_YARLI | 68.69% | 99 | 2e-32 | 60S ribosomal protein L36 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E30602g PE=3 SV=1 |
| A0A1E4TGV8_9ASCO | 67.35% | 98 | 4e-31 | 60S ribosomal protein L36 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31797 PE=3 SV=1 |
| RL36B_YEAST | 62.24% | 98 | 9e-29 | 60S ribosomal protein L36-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL36B PE=1 SV=3 |
| A0A1D8PH21_CANAL | 64.58% | 96 | 5e-27 | 60S ribosomal protein L36 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL39 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.8706
Predicted cleavage: 31
Protein family membership
- Ribosomal protein L36e (IPR000509)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_04438_1 MAAQKSGIAVGINKGHKVTPRTPAARFNRKKTPSTKTLFVRDIISEVAGLAPYERRVIELIRNSQEKRARKLAKKKLGTF GRAKAKVEQMTKVIAETRRAAH
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome