MIA_03637_1
Browser: contig04:1758455-1759889-
Protein function
EGGNOG: | 0PFEE | COQ6 | (Ubiquinone) biosynthesis |
---|---|---|---|
SGD closest match: | S000003487 | COQ6 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial |
CGD closest match: | CAL0000194332 | COQ6 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_04448_1 | 66.270% | 504 | 0.0 | MCA_04448_1 |
A0A0J9X5N2_GEOCN | 66.597% | 479 | 0.0 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Geotrichum candidum GN=COQ6 PE=3 SV=1 |
A0A167C296_9ASCO | 65.532% | 470 | 0.0 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Sugiyamaella lignohabitans GN=COQ6 PE=3 SV=1 |
UniRef50_A0A167C296 | 65.532% | 470 | 0.0 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167C296_9ASCO |
A0A1E3PM86_9ASCO | 59.322% | 472 | 0.0 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=COQ6 PE=3 SV=1 |
A0A060TCU6_BLAAD | 58.333% | 480 | 0.0 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Blastobotrys adeninivorans GN=COQ6 PE=3 SV=1 |
F2Z6J4_YARLI | 51.250% | 480 | 9.12e-149 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COQ6 PE=3 SV=1 |
A0A1E4TM13_9ASCO | 51.288% | 466 | 3.75e-138 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=COQ6 PE=3 SV=1 |
Q5AHZ4_CANAL | 47.095% | 482 | 2.02e-127 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COQ6 PE=3 SV=1 |
COQ6_YEAST | 44.181% | 464 | 7.76e-115 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9616
Predicted cleavage: 24
Protein family membership
- Ubiquinone biosynthesis hydroxylase UbiH/COQ6 (IPR010971)
- Ubiquinone biosynthesis monooxygenase COQ6 (IPR000689)
Domains and repeats
-
Domain
-
Domain
Detailed signature matches

-
PR00420 (RNGMNOXGNASE)
Protein sequence
>MIA_03637_1 MSIRRLSINISRARRITPFRNYSSSPEPYDVVIIGGGPAGLTLATALKNSPYTRSLKTLLVEGGSLAHIKDWAPGPDHYE NRVSSLTPRSAAFLKRLGAWDGHITQERVKAYDEMKVWDGLDSARIEFSPDILGQNVDIAYMIENFNLQHGLLSRLAELN AENADVQTVIKDKARVKSIDTGDWPVVELESGEKFTARLLVGADGGNSPARAFAKIESRGWDYNRHGLVASVKLEWEDFR AVAFQRFLKTGPIALLPLPDGFASLVWSCTPKMAAQLKSLPPAAFCSMVNAGFRLGPVDIEYMLNAAPAGKSDEEISAWV QDELEWRLENVELVDEDNNLPIQIVDVLPKSRASFPLKMKHADTYVAERVALVGDAAHTTHPLAGQGLNMGQQDVESLVG ALETATRRGLDIGSLLAIEPYWSERYFANHLKLGVVDKLHKLYSFDAAPIVALRSWGLSFVNSLDTIKRELMRQASN
GO term prediction
Biological Process
GO:0006744 ubiquinone biosynthetic process
GO:0055114 oxidation-reduction process
Molecular Function
GO:0004497 monooxygenase activity
GO:0016491 oxidoreductase activity
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0050660 flavin adenine dinucleotide binding
GO:0071949 FAD binding
Cellular Component
None predicted.