MCA_04448_1
Gene name: COQ6
Description: Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
Browser: contigC:3077002-3078619-
RNA-seq: read pairs 2509, FPKM 57.5, percentile rank 68.4% (100% = highest expression)
Protein function
| Annotation: | COQ6 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial | |
|---|---|---|---|
| KEGG: | K06126 | COQ6 | ubiquinone biosynthesis monooxygenase Coq6 [EC:1.14.13.-] |
| EGGNOG: | 0PFEE | COQ6 | (Ubiquinone) biosynthesis |
| SGD closest match: | S000003487 | COQ6 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial |
| CGD closest match: | CAL0000194332 | COQ6 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03637_1 | 66.27% | 504 | 0.0 | MIA_03637_1 |
| A0A0J9X5N2_GEOCN | 59.15% | 519 | 0.0 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Geotrichum candidum GN=COQ6 PE=3 SV=1 |
| A0A167C296_9ASCO | 57.86% | 496 | 0.0 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Sugiyamaella lignohabitans GN=COQ6 PE=3 SV=1 |
| UniRef50_A0A167C296 | 57.86% | 496 | 0.0 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167C296_9ASCO |
| A0A1E3PM86_9ASCO | 53.73% | 536 | 0.0 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=COQ6 PE=3 SV=1 |
| A0A060TCU6_BLAAD | 53.09% | 501 | 4e-177 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Blastobotrys adeninivorans GN=COQ6 PE=3 SV=1 |
| F2Z6J4_YARLI | 46.03% | 504 | 1e-146 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COQ6 PE=3 SV=1 |
| Q5AHZ4_CANAL | 45.93% | 492 | 7e-142 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COQ6 PE=3 SV=1 |
| A0A1E4TM13_9ASCO | 45.83% | 504 | 7e-137 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Tortispora caseinolytica NRRL Y-17796 GN=COQ6 PE=3 SV=1 |
| COQ6_YEAST | 41.94% | 484 | 2e-118 | Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9934
Predicted cleavage: 39
Protein family membership
- Ubiquinone biosynthesis hydroxylase UbiH/COQ6 (IPR010971)
- Ubiquinone biosynthesis monooxygenase COQ6 (IPR000689)
Domains and repeats
-
Domain
-
Domain
Detailed signature matches
Protein sequence
>MCA_04448_1 MMSYNRNQTLKLFNKLVSARHVTRIPKSNIVYYTRRHYSSESSDSNKIEKYDVVVIGAGPAGMTLATALKSSPYTKDLKS VLIEGSKLDNIKNWNPPSDFYENRVISLTPRSVGFLKSIGAWEHINEDRVKSYDEMIVWDGLNDNARIDFTPDVLGENTD IAYMIEIFNLQHALYNRLQDLNAQDPKNTIDILDKSRVKTIYKQSQQPTIQDASAQGSTEVQAIESNDWPIIELESGKKF QARLLVGADGANSPARAFAGIESHGWNYNTHGLVATLELEWEDFRSVAFQRFLKTGPIAMLPLPDGFASLVWSCTPDMAR KLKALSPKAFCTMINIGFRLGKQDIEFILNDTFEKFQLLEKEVDLSAEEKEAKISEIEEELQSEFDWRLANVELVDEDNN YPIYVKDVLDKSRASFPLKMKHADTYVAERVALVGDAAHSTHPLAGQGLNMGQQDVESLVKSLETATKRGLDIGSLLAIE PYWSERYFPNHLKLGVVDKLHKLYSSDFGPLVQLRSWGLNIVNGLDIIKKELMKQASN
GO term prediction
Biological Process
GO:0006744 ubiquinone biosynthetic process
GO:0055114 oxidation-reduction process
Molecular Function
GO:0004497 monooxygenase activity
GO:0016491 oxidoreductase activity
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0050660 flavin adenine dinucleotide binding
GO:0071949 FAD binding
Cellular Component
None predicted.
no IPR