Protein

MIA_03636_1

Length
214 amino acids


Browser: contig04:1757776-1758421+

Protein function

EGGNOG:0PN0DRPB5DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity)
SGD closest match:S000000358RPB5DNA-directed RNA polymerases I, II, and III subunit RPABC1
CGD closest match:CAL0000198535orf19.6340DNA-directed RNA polymerase core subunit

Protein alignments

%idAln lengthE-value
A0A0J9XBM8_GEOCN80.374%2147.83e-135Similar to Saccharomyces cerevisiae YBR154C RPB5 RNA polymerase subunit ABC27 common to RNA polymerases I,II, and III OS=Geotrichum candidum GN=BN980_GECA08s02639g PE=3 SV=1
MCA_04447_181.905%2104.68e-133MCA_04447_1
A0A1D8PFJ8_CANAL69.159%2141.15e-116DNA-directed RNA polymerase core subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6340 PE=3 SV=1
A0A1E3PUJ8_9ASCO71.028%2143.03e-116DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_55351 PE=3 SV=1
UniRef50_B9W9S068.692%2147.29e-113DNA-directed RNA polymerases I, II and III subunit, putative n=7 Tax=Dikarya TaxID=451864 RepID=B9W9S0_CANDC
RPAB1_YEAST64.789%2139.16e-111DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB5 PE=1 SV=1
A0A1E4TJC0_9ASCO65.888%2143.32e-109Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_76759 PE=3 SV=1
A0A060T955_BLAAD66.038%2125.18e-107ARAD1D08954p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D08954g PE=3 SV=1
RPAB1_YARLI61.836%2072.99e-100DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPB5 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3396

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 160 180 200 214

Detailed signature matches

    1. MF_00025 (RNApol_Rp...)
    1. SSF53036 (Eukaryoti...)
    2. PF03871 (RNA_pol_Rp...)
    1. SSF55287 (RPB5-like...)
    2. PF01191 (RNA_pol_Rp...)
    1. PS01110 (RNA_POL_H_...)

Protein sequence

>MIA_03636_1
MEDPERVASRLWRVYRTTKEMVRDRGYLILQKEIDITLDEFRAQFCDSMGNVTRKMMSYQATPTDETLAKFPTLGTLWVE
FCDEATVGVRTMDNLCLHVLEKNFQTAIFVYQNSLSPGAVRKISSVEPASIDTFQENDLVVNITHHVLVPKHLVLSTDEK
KELLTRYKLKESQLPRIQREDPIARYLGLKRGQVVKIIRLSPTAGRYASYRICL

GO term prediction

Biological Process

GO:0006351 transcription, DNA-templated

Molecular Function

GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity

Cellular Component

GO:0005634 nucleus