Protein

MIA_03608_1

Length
253 amino acids


Browser: contig04:1679289-1680472+

Protein function

EGGNOG:0PJ94VPS29vacuolar protein
SGD closest match:S000001054VPS29Vacuolar protein sorting-associated protein 29
CGD closest match:CAL0000193936orf19.6076Vacuolar protein sorting-associated protein 29

Protein alignments

%idAln lengthE-value
A0A0J9X4B6_GEOCN74.510%1534.24e-78Vacuolar protein sorting-associated protein 29 OS=Geotrichum candidum GN=BN980_GECA02s05004g PE=3 SV=1
A0A060SY27_BLAAD63.399%1532.84e-70Vacuolar protein sorting-associated protein 29 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17380g PE=3 SV=1
Q5AB94_CANAL44.697%2643.78e-65Vacuolar protein sorting-associated protein 29 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6076 PE=3 SV=1
UniRef50_U4LN2963.158%1524.34e-62Vacuolar protein sorting-associated protein 29 n=2 Tax=saccharomyceta TaxID=716545 RepID=U4LN29_PYROM
A0A1E4TIL4_9ASCO52.980%1514.42e-53Vacuolar protein sorting-associated protein 29 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_73201 PE=3 SV=1
Q6C594_YARLI52.410%1661.32e-50Vacuolar protein sorting-associated protein 29 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19987g PE=3 SV=1
A0A1E3PF02_9ASCO51.724%1743.11e-49Vacuolar protein sorting-associated protein 29 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47746 PE=3 SV=1
VPS29_YEAST50.617%1622.91e-48Vacuolar protein sorting-associated protein 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS29 PE=1 SV=1
MCA_04070_174.000%1001.14e-46MCA_04070_1
A0A167E5Z6_9ASCO76.923%781.34e-40Vacuolar protein sorting-associated protein 29 OS=Sugiyamaella lignohabitans GN=VPS29 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0247

Protein family membership

Domains and repeats

1 50 100 150 200 253

Detailed signature matches

    1. cd07394 (MPP_Vps29)
    1. SSF56300 (Metallo-d...)
    1. PF12850 (Metallophos_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. Vps29:Vps35 subcom...
  2. metal binding site...
  3. active site cd07394

Protein sequence

>MIA_03608_1
MLVLVIGDLHIPDRAIEIPAKFRKLLVPGKIEKVLCLGNITDRETLHYLQGLSREFLAVKGEFDDPPVRPATAVESISLP
LSRVVTLGELRIGFNSGHTIVPNSDPDALLIAARQLDVDIFIWGGTHRVEAYKLEGKFFVNPGSATGAFYTGWPDPEDDD
DDEEEEGDEEEEKGDGEKPKDGEEEGKSDGAEGDDKPKDGEEKEKADVEIVDIKDPIPSFCLLDIQGTVCVVYIYRYIDG
EVKVDKINYRRDE

GO term prediction

Biological Process

GO:0042147 retrograde transport, endosome to Golgi

Molecular Function

None predicted.

Cellular Component

GO:0030904 retromer complex