Protein

MCA_04070_1

Length
360 amino acids


Gene name: VPS29

Description: Vacuolar protein sorting-associated protein 29

Browser: contigC:1943192-1944499-

RNA-seq: read pairs 3952, FPKM 135.3, percentile rank 83.6% (100% = highest expression)

Protein function

Annotation:VPS29Vacuolar protein sorting-associated protein 29
KEGG:K18467VPS29 vacuolar protein sorting-associated protein 29
EGGNOG:0PJ94VPS29vacuolar protein
SGD closest match:S000001054VPS29Vacuolar protein sorting-associated protein 29
CGD closest match:CAL0000193936orf19.6076Vacuolar protein sorting-associated protein 29

Protein alignments

%idAln lengthE-value
A0A0J9X4B6_GEOCN63.69%1792e-71Vacuolar protein sorting-associated protein 29 OS=Geotrichum candidum GN=BN980_GECA02s05004g PE=3 SV=1
MIA_03608_159.50%2006e-69MIA_03608_1
A0A167E5Z6_9ASCO53.01%1833e-58Vacuolar protein sorting-associated protein 29 OS=Sugiyamaella lignohabitans GN=VPS29 PE=3 SV=1
UniRef50_A0A167E5Z653.01%1839e-55Vacuolar protein sorting-associated protein 29 n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167E5Z6_9ASCO
A0A060SY27_BLAAD49.73%1857e-55Vacuolar protein sorting-associated protein 29 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17380g PE=3 SV=1
VPS29_YEAST42.05%1951e-42Vacuolar protein sorting-associated protein 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS29 PE=1 SV=1
Q5AB94_CANAL40.38%2135e-43Vacuolar protein sorting-associated protein 29 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6076 PE=3 SV=1
Q6C594_YARLI44.44%1892e-42Vacuolar protein sorting-associated protein 29 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E19987g PE=3 SV=1
A0A1E3PF02_9ASCO49.37%1583e-40Vacuolar protein sorting-associated protein 29 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47746 PE=3 SV=1
A0A1E4TIL4_9ASCO43.35%1735e-40Vacuolar protein sorting-associated protein 29 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_73201 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0416

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 360

Detailed signature matches

    1. SSF56300 (Metallo-d...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_04070_1
MLVLVIGDLHIPDRAIDIPLKFKKLLVPGKIEKVLCLGNVTDRSTFQYLQSLSPEFLGVKGEFDDPIIYHRKKVPATQTL
AGQRSRNGLDNGIQPLASGSAASAAVSNSHYGIQTASAQGSIPTPSGNGNFIDPHNSDVMSNAPDGVNIHTLASVSGTQF
VDTYNKPYQQQQPQSNDSPRKSFLNTSPQFEVATSVVEELPLPLSRVVSLGQLKIGFNSGHTIIPNSDPDALLIAARQLD
VDIFIWGGTHRVEAYQLEGKFFVNPGSATGAFYTSWPDTEELEQETDSKNNEEEAKDDSRENEDSNESSNSNNGAVAEPK
DPIPSFCLLDIQGSICVVYIYRYVDGEVKVDKISYRKEDQ

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.