Protein
MIA_03556_1
Length
225 amino acids
Browser: contig04:1534974-1535698-
Protein function
EGGNOG: | 0PM03 | FG01020.1 | Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide- sensitive factor) attachment protein receptor (By similarity) |
---|---|---|---|
SGD closest match: | S000001023 | GOS1 | Golgi SNAP receptor complex member 1 |
CGD closest match: | CAL0000174632 | orf19.6551 | Golgi SNAP receptor complex member 1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_03290_1 | 59.914% | 232 | 1.26e-88 | MCA_03290_1 |
A0A060T1L7_BLAAD | 58.667% | 225 | 1.30e-85 | Golgi SNAP receptor complex member 1 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25696g PE=3 SV=1 |
A0A167DXT7_9ASCO | 56.444% | 225 | 1.74e-80 | Golgi SNAP receptor complex member 1 OS=Sugiyamaella lignohabitans GN=GOS1 PE=3 SV=1 |
UniRef50_A0A167DXT7 | 56.444% | 225 | 4.77e-77 | Golgi SNAP receptor complex member 1 n=7 Tax=saccharomyceta TaxID=716545 RepID=A0A167DXT7_9ASCO |
A0A1E3PSE0_9ASCO | 53.947% | 228 | 1.38e-79 | Golgi SNAP receptor complex member 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49000 PE=3 SV=1 |
A0A0J9X2E8_GEOCN | 55.895% | 229 | 1.51e-78 | Golgi SNAP receptor complex member 1 OS=Geotrichum candidum GN=BN980_GECA01s11967g PE=3 SV=1 |
Q6C825_YARLI | 52.444% | 225 | 1.08e-73 | Golgi SNAP receptor complex member 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D23353g PE=3 SV=1 |
A0A1E4TGK9_9ASCO | 41.629% | 221 | 9.64e-51 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_113159 PE=4 SV=1 |
GOSR1_YEAST | 39.189% | 222 | 7.55e-48 | Golgi SNAP receptor complex member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOS1 PE=1 SV=1 |
Q5AGY7_CANAL | 40.611% | 229 | 3.67e-45 | Golgi SNAP receptor complex member 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6551 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0088
Protein family membership
- Golgi SNAP receptor complex, subunit 1 (IPR023601)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
-
NON_CYTOPLASM... (N...)
-
PF12352 (V-SNARE_C)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_03556_1 MATFSQLRAQLRSLETDAQHLLSDFSGFAQSISSSATEEELRLSKDIEDNLAKREETIATLARSVSSEDTPSITKDHQLQ RHKETLAENRADYLRLINSIKQERVRTNLLSSVRTDIELHRARESNGSGRGVGMSDSDYMISERNRIDNSHSMADSILAQ AYETREEFARQRQSLSNVQRRLQNTLSHIPGINTLIAKVNTRKKRDSLILAGIITLCILFLLLVR
GO term prediction
Biological Process
GO:0006888 ER to Golgi vesicle-mediated transport
Molecular Function
None predicted.
Cellular Component
GO:0000139 Golgi membrane
GO:0005801 cis-Golgi network
GO:0016021 integral component of membrane