Protein
MCA_03290_1
Length
232 amino acids
Browser: contigB:3921786-3922569-
RNA-seq: read pairs 877, FPKM 46.5, percentile rank 63.6% (100% = highest expression)
Protein function
| KEGG: | K08495 | GOSR1 | golgi SNAP receptor complex member 1 |
|---|---|---|---|
| EGGNOG: | 0PM03 | FG01020.1 | Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide- sensitive factor) attachment protein receptor (By similarity) |
| SGD closest match: | S000001023 | GOS1 | Golgi SNAP receptor complex member 1 |
| CGD closest match: | CAL0000174632 | orf19.6551 | Golgi SNAP receptor complex member 1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03556_1 | 59.91% | 232 | 2e-75 | MIA_03556_1 |
| A0A060T1L7_BLAAD | 55.36% | 233 | 5e-68 | Golgi SNAP receptor complex member 1 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25696g PE=3 SV=1 |
| A0A0J9X2E8_GEOCN | 54.11% | 231 | 6e-64 | Golgi SNAP receptor complex member 1 OS=Geotrichum candidum GN=BN980_GECA01s11967g PE=3 SV=1 |
| A0A167DXT7_9ASCO | 48.72% | 234 | 2e-60 | Golgi SNAP receptor complex member 1 OS=Sugiyamaella lignohabitans GN=GOS1 PE=3 SV=1 |
| UniRef50_A0A167DXT7 | 48.72% | 234 | 5e-57 | Golgi SNAP receptor complex member 1 n=7 Tax=saccharomyceta TaxID=716545 RepID=A0A167DXT7_9ASCO |
| A0A1E3PSE0_9ASCO | 49.36% | 235 | 3e-56 | Golgi SNAP receptor complex member 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_49000 PE=3 SV=1 |
| Q6C825_YARLI | 50.52% | 192 | 6e-55 | Golgi SNAP receptor complex member 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D23353g PE=3 SV=1 |
| A0A1E4TGK9_9ASCO | 41.27% | 189 | 6e-39 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_113159 PE=4 SV=1 |
| Q5AGY7_CANAL | 38.92% | 185 | 7e-36 | Golgi SNAP receptor complex member 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6551 PE=3 SV=1 |
| GOSR1_YEAST | 34.39% | 189 | 5e-32 | Golgi SNAP receptor complex member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOS1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0049
Protein family membership
- Golgi SNAP receptor complex, subunit 1 (IPR023601)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
PF12352 (V-SNARE_C)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_03290_1 MASFAELRSKARSLETELSHLLEEYASFSQSLSSSATEAEVKLISQIEENMEKAKEVNNALTRALSSEQSPPATRTQQVQ RHKEKLTEQRSEFTRIKNNIQQERVRMNLLTSVQTDIDMHRSRRNNNSNSSSNDANNNPGANEADYMLQERNRIDNSHSM ADSILAQAYETREEFFRQRASLSGIQRRLQNTLSHFPGINTIIGKVNTRKKRDSLILASLITLCVLLLIFFR
GO term prediction
Biological Process
GO:0006888 ER to Golgi vesicle-mediated transport
Molecular Function
None predicted.
Cellular Component
GO:0000139 Golgi membrane
GO:0005801 cis-Golgi network
GO:0016021 integral component of membrane