Protein
MIA_03419_1
Length
103 amino acids
Browser: contig04:1165900-1166281+
Protein function
| EGGNOG: | 0PRWH | FG10793.1 | conserved hypothetical protein |
|---|---|---|---|
| SGD closest match: | S000004857 | COA6 | Cytochrome c oxidase assembly factor 6 |
| CGD closest match: | CAL0000192669 | CAALFM_CR10280WA | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04863_1 | 66.000% | 100 | 1.80e-46 | MCA_04863_1 |
| A0A060SWZ2_BLAAD | 54.945% | 91 | 4.84e-30 | ARAD1A04246p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A04246g PE=4 SV=1 |
| UniRef50_A0A060SWZ2 | 54.945% | 91 | 1.19e-26 | ARAD1A04246p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SWZ2_BLAAD |
| A0A1E3PK42_9ASCO | 48.387% | 93 | 1.82e-29 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51079 PE=4 SV=1 |
| Q6C767_YARLI | 48.387% | 93 | 3.32e-29 | YALI0E03344p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E03344g PE=4 SV=1 |
| COA6_YEAST | 41.772% | 79 | 2.44e-21 | Cytochrome c oxidase assembly factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA6 PE=1 SV=1 |
| A0A1E4TMH2_9ASCO | 44.578% | 83 | 1.01e-19 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_18064 PE=4 SV=1 |
| A0A1D8PU62_CANAL | 39.080% | 87 | 2.45e-18 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR10280WA PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3088
Protein family membership
- Cytochrome c oxidase, subunit VIb (IPR003213)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MIA_03419_1 MAAEHPNQDSVLKKSARKLCWDARDKYFACLDKANIVDVRKPENAAKSKQLCGSEETDFNKDCIASWVDYFRTKRANDWE RDQQLKKLQAQGAIPLDSTIRFK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005739 mitochondrion