Protein
MCA_04863_1
Length
109 amino acids
Gene name: COA6
Description: Cytochrome c oxidase assembly factor 6
Browser: contigC:4287096-4287755+
RNA-seq: read pairs 1176, FPKM 132.1, percentile rank 83.2% (100% = highest expression)
Protein function
Annotation: | COA6 | Cytochrome c oxidase assembly factor 6 | |
---|---|---|---|
KEGG: | K18179 | COA6 | cytochrome c oxidase assembly factor 6 |
EGGNOG: | 0PRWH | FG10793.1 | conserved hypothetical protein |
SGD closest match: | S000004857 | COA6 | Cytochrome c oxidase assembly factor 6 |
CGD closest match: | CAL0000192669 | CAALFM_CR10280WA | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03419_1 | 67.02% | 94 | 2e-41 | MIA_03419_1 |
A0A060SWZ2_BLAAD | 56.18% | 89 | 2e-31 | ARAD1A04246p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A04246g PE=4 SV=1 |
UniRef50_A0A060SWZ2 | 56.18% | 89 | 4e-28 | ARAD1A04246p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SWZ2_BLAAD |
A0A1E3PK42_9ASCO | 51.65% | 91 | 2e-31 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51079 PE=4 SV=1 |
Q6C767_YARLI | 49.45% | 91 | 7e-31 | YALI0E03344p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E03344g PE=4 SV=1 |
COA6_YEAST | 41.00% | 100 | 3e-20 | Cytochrome c oxidase assembly factor 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COA6 PE=1 SV=1 |
A0A1D8PU62_CANAL | 41.38% | 87 | 1e-17 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR10280WA PE=4 SV=1 |
A0A1E4TMH2_9ASCO | 39.76% | 83 | 6e-15 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_18064 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0060
Protein family membership
- Cytochrome c oxidase, subunit VIb (IPR003213)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_04863_1 MGLFSSSQPEPQHPPQETVIKKSARKLCWDARDKLFACLDKNNIIDAIKNDSEVKAKCGPEDAEYNKDCISSWVTYFKEK RAKEWERDQRLKQLQSEGAIPLESTIRFK
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005739 mitochondrion