Protein
MIA_03349_1
Length
117 amino acids
Browser: contig04:959972-960663-
Protein function
| EGGNOG: | 0PST4 | ATP14 | subunit h EC 3.6.3.14 |
|---|---|---|---|
| CGD closest match: | CAL0000181045 | ATP14 | F1F0 ATP synthase subunit h |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02905_1 | 77.660% | 94 | 1.03e-41 | MCA_02905_1 |
| A0A0J9X2D6_GEOCN | 68.889% | 90 | 2.09e-28 | Similar to Saccharomyces cerevisiae YLR295C ATP14 Subunit h of the F0 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA01s00450g PE=4 SV=1 |
| UniRef50_A0A1E3QEQ6 | 54.255% | 94 | 6.76e-18 | Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3QEQ6_LIPST |
| A0A060T3U0_BLAAD | 49.425% | 87 | 1.47e-17 | ARAD1C36432p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C36432g PE=4 SV=1 |
| Q6C2V6_YARLI | 46.067% | 89 | 1.40e-11 | YALI0F04774p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04774g PE=4 SV=1 |
| A0A1E3PS33_9ASCO | 53.731% | 67 | 1.51e-10 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48895 PE=4 SV=1 |
| A0A1D8PHL7_CANAL | 40.000% | 95 | 7.82e-09 | F1F0 ATP synthase subunit h OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP14 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9874
Predicted cleavage: 30
Protein family membership
- ATP synthase, F0 complex, subunit H (IPR019711)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF10775 (ATP_sub_h)
-
Protein sequence
>MIA_03349_1 MIAPVLRVAARRAPIVASRRAISVSAVRLNLIQDLYVKEIKGYKAPPLTVADAQGSVKPWATPSAPAPPAVEGDVAADLA AYESSTVEVESHAPVAEGAEPVVEDWFVIEPANDLHH
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
None predicted.
Cellular Component
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)