Protein

MCA_02905_1

Length
117 amino acids

Gene name: ATP14

Description: ATP synthase subunit H, mitochondrial

Browser: contigB:2704040-2704993+

RNA-seq: read pairs 24632, FPKM 2579.3, percentile rank 98.1% (100% = highest expression)

Protein function

Annotation:ATP14ATP synthase subunit H, mitochondrial
KEGG:K02141ATPeFH F-type H+-transporting ATPase subunit h
EGGNOG:0PST4ATP14subunit h EC 3.6.3.14
SGD closest match:S000004286ATP14ATP synthase subunit H, mitochondrial

Protein alignments

%idAln lengthE-value
MIA_03349_176.07%1172e-33MIA_03349_1
A0A0J9X2D6_GEOCN57.26%1174e-27Similar to Saccharomyces cerevisiae YLR295C ATP14 Subunit h of the F0 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA01s00450g PE=4 SV=1
UniRef50_A0A1E3QEQ654.55%884e-13Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3QEQ6_LIPST
Q6C2V6_YARLI46.34%823e-11YALI0F04774p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04774g PE=4 SV=1
A0A060T3U0_BLAAD47.87%945e-11ARAD1C36432p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C36432g PE=4 SV=1
ATP14_YEAST46.43%564e-09ATP synthase subunit H, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP14 PE=1 SV=1
A0A1E3PS33_9ASCO48.57%703e-08Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48895 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9917
Predicted cleavage: 30

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR019711
    ATP synthase, F0 complex, subunit H
    1. PF10775 (ATP_sub_h)

Protein sequence

>MCA_02905_1
MIAPVIRLSARRLPTMVSRRAISVSAVRSNLIQDLYIKEIKGYKAPPLTLKDAEGSVKPWTPPAAPSAPSVEGDVAADLA
AYESSSVEVESQASTSSTPEAAVEDWFVIEPANDLHH

GO term prediction

Biological Process

GO:0015986 ATP synthesis coupled proton transport

Molecular Function

None predicted.

Cellular Component

GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)