Protein

MIA_03346_1

Length
197 amino acids

Browser: contig04:952182-952928-

Protein function

EGGNOG:0PMXYHAM1Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions (By similarity)
SGD closest match:S000003830HAM1Inosine triphosphate pyrophosphatase
CGD closest match:CAL0000174774HAM1Inosine triphosphate pyrophosphatase

Protein alignments

%idAln lengthE-value
A0A0J9XAR7_GEOCN67.196%1893.74e-91Inosine triphosphate pyrophosphatase OS=Geotrichum candidum GN=HAM1 PE=3 SV=1
MCA_01355_164.767%1931.11e-82MCA_01355_1
A0A060T6L7_BLAAD63.441%1861.71e-81Inosine triphosphate pyrophosphatase OS=Blastobotrys adeninivorans GN=HAM1 PE=3 SV=1
UniRef50_Q6BIT757.576%1984.50e-75Inosine triphosphate pyrophosphatase n=46 Tax=Eukaryota TaxID=2759 RepID=ITPA_DEBHA
A0A1E3PP85_9ASCO57.292%1923.56e-76Inosine triphosphate pyrophosphatase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=HAM1 PE=3 SV=1
ITPA_CANAL55.172%2031.69e-74Inosine triphosphate pyrophosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAM1 PE=3 SV=1
ITPA_YARLI60.104%1933.61e-74Inosine triphosphate pyrophosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAM1 PE=3 SV=1
A0A1E4TBK4_9ASCO51.562%1921.36e-62Inosine triphosphate pyrophosphatase OS=Tortispora caseinolytica NRRL Y-17796 GN=HAM1 PE=3 SV=1
ITPA_YEAST47.980%1984.96e-50Inosine triphosphate pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAM1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2492

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR029001
    Inosine triphosphate pyrophosphatase-like
    1. SSF52972 (ITPase-like)
    2. G3DSA:3.90.95...
  2. Family IPR002637
    Ham1-like protein
    1. TIGR00042
    2. PF01725 (Ham1p_like)
    3. cd00515 (HAM1)
  3. Family IPR027502
    Inosine triphosphate pyrophosphatase
    1. MF_03148 (HAM1_NTPase)

Residue annotation

  1. active site cd00515
  2. dimerization inter...

Protein sequence

>MIA_03346_1
MSKATVTFVTGNANKLREVQQILGAEGIGKTITNQKVDLEEVQGTLNDVTIAKTRKAAEIINGPVLVEDTGLEFNGLKGL
PGPYIKWFLESLGNQGLYDMLYKFEDKTGRAICTFGFSEGPGSEVLLFQGIVDGTIVSPRGPKDPSKPVFGWNPIFEPKG
YTETYAEMDGEQKNAISHRYVALMKLKEFLEKRAESA

GO term prediction

Biological Process

GO:0009143 nucleoside triphosphate catabolic process

Molecular Function

GO:0047429 nucleoside-triphosphate diphosphatase activity

Cellular Component

None predicted.