Protein
MCA_01355_1
Length
189 amino acids
Gene name: HAM1
Description: Inosine triphosphate pyrophosphatase
Browser: contigA:4231410-4231980-
RNA-seq: read pairs 435, FPKM 28.3, percentile rank 51.1% (100% = highest expression)
Protein function
Annotation: | HAM1 | Inosine triphosphate pyrophosphatase | |
---|---|---|---|
KEGG: | K01519 | ITPA | inosine triphosphate pyrophosphatase [EC:3.6.1.-] |
EGGNOG: | 0PMXY | HAM1 | Pyrophosphatase that hydrolyzes non-canonical purine nucleotides such as inosine triphosphate (ITP), deoxyinosine triphosphate (dITP) or xanthosine 5'-triphosphate (XTP) to their respective monophosphate derivatives. The enzyme does not distinguish between the deoxy- and ribose forms. Probably excludes non-canonical purines from RNA and DNA precursor pools, thus preventing their incorporation into RNA and DNA and avoiding chromosomal lesions (By similarity) |
SGD closest match: | S000003830 | HAM1 | Inosine triphosphate pyrophosphatase |
CGD closest match: | CAL0000174774 | HAM1 | Inosine triphosphate pyrophosphatase |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
ITPA_YARLI | 68.24% | 170 | 1e-73 | Inosine triphosphate pyrophosphatase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAM1 PE=3 SV=1 |
MIA_03346_1 | 64.97% | 177 | 3e-73 | MIA_03346_1 |
A0A0J9XAR7_GEOCN | 64.88% | 168 | 4e-72 | Inosine triphosphate pyrophosphatase OS=Geotrichum candidum GN=HAM1 PE=3 SV=1 |
UniRef50_A0A099P338 | 62.92% | 178 | 7e-67 | Inosine triphosphate pyrophosphatase n=11 Tax=Opisthokonta TaxID=33154 RepID=A0A099P338_PICKU |
ITPA_CANAL | 56.84% | 190 | 7e-69 | Inosine triphosphate pyrophosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAM1 PE=3 SV=1 |
A0A060T6L7_BLAAD | 63.69% | 168 | 8e-69 | Inosine triphosphate pyrophosphatase OS=Blastobotrys adeninivorans GN=HAM1 PE=3 SV=1 |
A0A1E3PP85_9ASCO | 63.10% | 168 | 4e-68 | Inosine triphosphate pyrophosphatase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=HAM1 PE=3 SV=1 |
A0A1E4TBK4_9ASCO | 52.63% | 171 | 2e-52 | Inosine triphosphate pyrophosphatase OS=Tortispora caseinolytica NRRL Y-17796 GN=HAM1 PE=3 SV=1 |
ITPA_YEAST | 46.63% | 178 | 3e-39 | Inosine triphosphate pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAM1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0701
Predicted cleavage: 17
Protein family membership
- Inosine triphosphate pyrophosphatase-like (IPR029001)
- Ham1-like protein (IPR002637)
- Inosine triphosphate pyrophosphatase (IPR027502)
- Ham1-like protein (IPR002637)
Domains and repeats
None predicted.
Detailed signature matches
Residue annotation
-
active site cd00515
-
dimerization inter...
Protein sequence
>MCA_01355_1 MKTITFVTGNAGKLREVVEILGANSPIVNKKLDLEEVQGTVDEVTIKKAKAAAAILNGPALVEDTSLVFNAYNGLPGPYI KWFMESLGNEGLIKMLAGFEDKSATAICTFGYCESPDSDVILFQGKLDGTIVPKPRGEGNFGWNPIFEPKGYDKTFAEMS GSLKNSISHRYLALMKLKKFLEEKMASEN
GO term prediction
Biological Process
GO:0009143 nucleoside triphosphate catabolic process
Molecular Function
GO:0047429 nucleoside-triphosphate diphosphatase activity
Cellular Component
None predicted.