Protein

MIA_03331_1

Length
371 amino acids

Browser: contig04:888161-889303+

Protein function

EGGNOG:0PFVSUBA4Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Acts by mediating the C-terminal thiocarboxylation of sulfur carrier URM1. Its N-terminus first activates URM1 as acyl-adenylates (- COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 to form thiocarboxylation (-COSH) of its C- terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor
SGD closest match:S000001153UBA4Adenylyltransferase and sulfurtransferase UBA4
CGD closest match:CAL0000183559UBA4Adenylyltransferase and sulfurtransferase UBA4

Protein alignments

%idAln lengthE-value
MCA_05438_157.143%3922.74e-136MCA_05438_1
A0A060T6F3_BLAAD53.388%3697.12e-124Adenylyltransferase and sulfurtransferase UBA4 OS=Blastobotrys adeninivorans GN=UBA4 PE=3 SV=1
A0A0J9XFU0_GEOCN53.316%3771.55e-115Adenylyltransferase and sulfurtransferase UBA4 OS=Geotrichum candidum GN=UBA4 PE=3 SV=1
A0A161HII4_9ASCO54.142%3382.87e-114Uba4p OS=Sugiyamaella lignohabitans GN=UBA4 PE=4 SV=1
UBA4_YARLI50.137%3658.18e-111Adenylyltransferase and sulfurtransferase UBA4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBA4 PE=3 SV=1
UniRef50_Q6CBK150.137%3651.90e-107Adenylyltransferase and sulfurtransferase UBA4 n=13 Tax=Saccharomycetales TaxID=4892 RepID=UBA4_YARLI
A0A1E3PPZ9_9ASCO46.631%3711.30e-100Adenylyltransferase and sulfurtransferase UBA4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=UBA4 PE=3 SV=1
UBA4_CANAL44.385%3741.00e-99Adenylyltransferase and sulfurtransferase UBA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBA4 PE=3 SV=1
UBA4_YEAST42.328%3784.13e-94Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA4 PE=1 SV=1
A0A1E4TJA5_9ASCO42.234%3672.40e-72Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147418 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1411

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 371

Detailed signature matches

  1. Domain IPR000594
    THIF-type NAD/FAD binding fold
    1. PF00899 (ThiF)
    2. SSF69572 (Activatin...)
  2. Domain IPR001763
    Rhodanese-like domain
    1. G3DSA:3.40.25...
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. cd00757 (ThiF_MoeB_...)

Residue annotation

  1. ATP binding site c...
  2. substrate interfac...

Protein sequence

>MIA_03331_1
MSLDLDEYLRYGRQMIVPEFGGLSTQTDLQKSSILIIGAGGLGCPAIAYLAGAGVGSLTIVDGDTVEASNLHRQVVHSTA
TVGEYKAVSAAKFVANLNPHVKVRTVTSNLTLDNVFNVIRTKETAAAESGPWDFDVILDCSDNPATRYLVNDAAVLANTP
LVSASALKTEGQLCLLNFQRGPCYRCFFPVPPPANSVVACGDGGILGPVVGMMGVYQALEAIKIVAKIYEGPEPKQQYTP
ALMLFSALSFPPWRSMRMRGAKPGCAACDPTSPVTRKDIEARDYAAFCGHVEGPRISPEERISAGNYSQVVKSGKKHVLI
DVRPRAHFGICSLPNSINIPLDELQTMDGTKIKDLTQWGDDPIYVVCRHHH

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0008641 small protein activating enzyme activity

Cellular Component

None predicted.