Protein

MCA_05438_1

Length
440 amino acids

Gene name: UBA4

Description: Adenylyltransferase and sulfurtransferase UBA4

Browser: contigD:1327148-1328471-

RNA-seq: read pairs 851, FPKM 23.8, percentile rank 46.2% (100% = highest expression)

Protein function

Annotation:UBA4Adenylyltransferase and sulfurtransferase UBA4
KEGG:K11996MOCS3 adenylyltransferase and sulfurtransferase [EC:2.7.7.80 2.8.1.11]
EGGNOG:0PFVSUBA4Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Acts by mediating the C-terminal thiocarboxylation of sulfur carrier URM1. Its N-terminus first activates URM1 as acyl-adenylates (- COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 to form thiocarboxylation (-COSH) of its C- terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor
SGD closest match:S000001153UBA4Adenylyltransferase and sulfurtransferase UBA4
CGD closest match:CAL0000183559UBA4Adenylyltransferase and sulfurtransferase UBA4

Protein alignments

%idAln lengthE-value
MIA_03331_156.89%3921e-133MIA_03331_1
A0A0J9XFU0_GEOCN49.09%4383e-130Adenylyltransferase and sulfurtransferase UBA4 OS=Geotrichum candidum GN=UBA4 PE=3 SV=1
A0A060T6F3_BLAAD50.11%4375e-129Adenylyltransferase and sulfurtransferase UBA4 OS=Blastobotrys adeninivorans GN=UBA4 PE=3 SV=1
UBA4_YARLI47.62%4412e-116Adenylyltransferase and sulfurtransferase UBA4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBA4 PE=3 SV=1
UniRef50_Q6CBK147.62%4415e-113Adenylyltransferase and sulfurtransferase UBA4 n=13 Tax=Saccharomycetales TaxID=4892 RepID=UBA4_YARLI
A0A1E3PPZ9_9ASCO44.95%4364e-111Adenylyltransferase and sulfurtransferase UBA4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=UBA4 PE=3 SV=1
A0A161HII4_9ASCO50.71%3532e-105Uba4p OS=Sugiyamaella lignohabitans GN=UBA4 PE=4 SV=1
UBA4_CANAL42.38%4462e-102Adenylyltransferase and sulfurtransferase UBA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBA4 PE=3 SV=1
UBA4_YEAST40.59%4412e-95Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA4 PE=1 SV=1
A0A1E4TJA5_9ASCO39.68%4362e-83Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147418 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0880

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 440

Detailed signature matches

  1. Family IPR028885
    Adenylyltransferase and sulfurtransferase MOCS3/Uba4
    1. MF_03049 (MOCS3_Uba4)
  2. Domain IPR000594
    THIF-type NAD/FAD binding fold
    1. PF00899 (ThiF)
    2. SSF69572 (Activatin...)
  3. Domain IPR001763
    Rhodanese-like domain
    1. SM00450 (rhod_4)
    2. PF00581 (Rhodanese)
    3. G3DSA:3.40.25...
    4. PS50206 (RHODANESE_3)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. cd00757 (ThiF_MoeB_...)

Residue annotation

  1. ATP binding site c...
  2. substrate interfac...

Protein sequence

>MCA_05438_1
MTDLLDTSEYLRYGRQMLVPEFGFPAQLLLKKSHVLVIGAGGLGCPAIPYLAGSGIGYLSIVDGDIVEESNLHRQVIHST
ETVGMPKAKSAKRFVQKLNDKVKVKAYCTPVTNQNIFNILNGGNNISNEDDDSTDNEQWKKADVVLDCTDNPATRYLISD
AAVILGIPLVSASALKTEGQISVLNYLNGPCYRCFYPNPPPANAVVACGDGGILGPVVGMMGVYQALEAIKIISKVYEPS
NDNEEPIQKYQPSLAIFSALAFPPWRCIRMRGKKTGCISCDSSCPNQIKQAQIEDGSLDYQSFCGATCSTLSILPKEKRI
SASEYEAKYFKSGKPHVLIDVRPKVQYEICALPNSINIPLEDFPKLSEIKEKTTEKARLWSDLIEKEPIITVCRRGNNSQ
IAVTKIEEYLQNVGVDKPVIDIIGGVTAWSKDVDPNFPIY

GO term prediction

Biological Process

GO:0002143 tRNA wobble position uridine thiolation

Molecular Function

GO:0004792 thiosulfate sulfurtransferase activity
GO:0008641 small protein activating enzyme activity

Cellular Component

GO:0005829 cytosol