Protein

MIA_03328_1

Length
376 amino acids


Browser: contig04:883650-884781+

Protein function

EGGNOG:0PHHCCIA1Essential component of the cytosolic iron-sulfur (Fe S) protein assembly machinery. Required for the maturation of extramitochondrial Fe S proteins (By similarity)
SGD closest match:S000002675CIA1Cytosolic iron-sulfur protein assembly protein 1
CGD closest match:CAL0000178398CIA1Probable cytosolic iron-sulfur protein assembly protein 1

Protein alignments

%idAln lengthE-value
MCA_05673_169.272%3710.0MCA_05673_1
A0A0J9X3S3_GEOCN62.434%3781.99e-164Probable cytosolic iron-sulfur protein assembly protein 1 OS=Geotrichum candidum GN=CIA1 PE=3 SV=1
A0A1E3PIQ7_9ASCO60.163%3691.68e-159Probable cytosolic iron-sulfur protein assembly protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=CIA1 PE=3 SV=1
A0A060T6G3_BLAAD60.331%3631.40e-154Probable cytosolic iron-sulfur protein assembly protein 1 OS=Blastobotrys adeninivorans GN=CIA1 PE=3 SV=1
CIAO1_YARLI58.470%3661.11e-145Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1
UniRef50_Q6CBI858.470%3662.56e-142Probable cytosolic iron-sulfur protein assembly protein 1 n=8 Tax=saccharomyceta TaxID=716545 RepID=CIAO1_YARLI
CIAO1_CANAL47.680%3882.05e-108Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=2
A0A1E4T9R3_9ASCO46.154%3771.30e-96Probable cytosolic iron-sulfur protein assembly protein 1 OS=Tortispora caseinolytica NRRL Y-17796 GN=CIA1 PE=3 SV=1
CIAO1_YEAST44.628%3631.55e-92Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1
A0A167DEH0_9ASCO54.737%1906.37e-68Cia1p OS=Sugiyamaella lignohabitans GN=CIA1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0199

Protein family membership

Domains and repeats

  1. Domain
  2. Repeat
  3. Repeat
1 50 100 150 200 250 300 350 376

Detailed signature matches

    1. MF_03037 (ciao1)
    1. SSF50978 (WD40 repe...)
    2. PS50294 (WD_REPEATS...)
    1. PF00400 (WD40)
    2. PS50082 (WD_REPEATS_2)
    3. SM00320 (WD40_4)
    1. PR00320 (GPROTEINBRPT)
    1. PS00678 (WD_REPEATS_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd00200 (WD40)

Residue annotation

  1. structural tetrad ...

Protein sequence

>MIA_03328_1
MSEKTEDSHKPLYVLTGHKDRVWDISVHPKLPLLATCSGDRTARIYALNKPDVPLVASLADSHKRSVRSVAWKPTGGEDG
YPSLALGSFDATVSVWGREPYEEDEEIKGLDREGEWAFLATIEGHENEVKGVAWSSDGYILATCSRDKSVWVWETDDTNE
EFECIMFLQDHTEDVKHVVWHPSQQTFASASYDNTVRLWREDDDEWICVAVLQGHESTVWSCDFETDTKHKNTEEPSSCQ
PARLVSASDDLKCIVWRRTDSTGGTPKGGIPSTFRSDPLSETWIKETVLPESHTRTIYSVSWSPNSGRIASVGSDGRITV
YKEKAEGSGEWEIESVIDKAHGVYEINSVAWAPNYQGDGELLITAGDDCTTKIWKL

GO term prediction

Biological Process

GO:0016226 iron-sulfur cluster assembly

Molecular Function

GO:0005515 protein binding

Cellular Component

GO:0097361 CIA complex