Protein

MCA_05673_1

Length
375 amino acids


Gene name: CIA1

Description: Probable cytosolic iron-sulfur protein assembly protein 1

Browser: contigD:2003340-2004468+

RNA-seq: read pairs 939, FPKM 30.9, percentile rank 53.5% (100% = highest expression)

Protein function

Annotation:CIA1Probable cytosolic iron-sulfur protein assembly protein 1
EGGNOG:0PHHCCIA1Essential component of the cytosolic iron-sulfur (Fe S) protein assembly machinery. Required for the maturation of extramitochondrial Fe S proteins (By similarity)
SGD closest match:S000002675CIA1Cytosolic iron-sulfur protein assembly protein 1
CGD closest match:CAL0000178398CIA1Probable cytosolic iron-sulfur protein assembly protein 1

Protein alignments

%idAln lengthE-value
MIA_03328_169.27%3712e-175MIA_03328_1
A0A060T6G3_BLAAD60.67%3567e-147Probable cytosolic iron-sulfur protein assembly protein 1 OS=Blastobotrys adeninivorans GN=CIA1 PE=3 SV=1
A0A0J9X3S3_GEOCN60.37%3767e-147Probable cytosolic iron-sulfur protein assembly protein 1 OS=Geotrichum candidum GN=CIA1 PE=3 SV=1
A0A1E3PIQ7_9ASCO57.30%3706e-142Probable cytosolic iron-sulfur protein assembly protein 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=CIA1 PE=3 SV=1
CIAO1_YARLI56.35%3624e-129Probable cytosolic iron-sulfur protein assembly protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CIA1 PE=3 SV=1
UniRef50_Q6CBI856.35%3629e-126Probable cytosolic iron-sulfur protein assembly protein 1 n=8 Tax=saccharomyceta TaxID=716545 RepID=CIAO1_YARLI
CIAO1_CANAL45.48%3874e-103Probable cytosolic iron-sulfur protein assembly protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CIA1 PE=3 SV=2
CIAO1_YEAST44.01%3593e-90Cytosolic iron-sulfur protein assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CIA1 PE=1 SV=1
A0A1E4T9R3_9ASCO44.17%3694e-87Probable cytosolic iron-sulfur protein assembly protein 1 OS=Tortispora caseinolytica NRRL Y-17796 GN=CIA1 PE=3 SV=1
A0A167DEF6_9ASCO66.20%1429e-58Cia1p OS=Sugiyamaella lignohabitans GN=CIA1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0489

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Repeat
1 50 100 150 200 250 300 350 375

Detailed signature matches

    1. MF_03037 (ciao1)
    1. SSF50978 (WD40 repe...)
    2. PS50294 (WD_REPEATS...)
    1. PF00400 (WD40)
    2. PS50082 (WD_REPEATS_2)
    3. SM00320 (WD40_4)
    1. PS00678 (WD_REPEATS_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd00200 (WD40)

Residue annotation

  1. structural tetrad ...

Protein sequence

>MCA_05673_1
MDRHTIKDRQVYTNYKLIKSLKDHQDRVWDLSVHPKLPLLATCSGDQTARIYSLNTPDFSSVSVLEGSHKRSIRSVAWKP
TGGEEGYPSLALGSFDATVSIWGREPADPESGESEDEWSFIATIEGHENEVKGVSWSPNGYLLSTCSRDKSVWVWETDED
NEEFECITFLQDHTEDVKHVTWHRKLETFASASYDNTIMIWAEDDGEWVCTSTLKGHKSTVWCCDFELDTKSTADSTFIP
ARLASCSDDGTCIVWRKTDSTGGTSKGGIPSTFRSDPLSETWSQESILPIAHAGAIYSISWSPYSGRIASVGSDGRVAVY
KEVDEKWEIETIIEKAHGVYEINSVTWAPNYLDKESTEFLITAGDDSCTNIWKIS

GO term prediction

Biological Process

GO:0016226 iron-sulfur cluster assembly

Molecular Function

GO:0005515 protein binding

Cellular Component

GO:0097361 CIA complex