MIA_03313_1

Protein

Length

135 amino acids

EGGNOG:	0PRGV	ATP20	subunit g
SGD closest match:	S000006224	ATP20	ATP synthase subunit g, mitochondrial
CGD closest match:	CAL0000179249	ATP20	F1F0 ATP synthase subunit g

	%id	Aln length	E-value
MCA_06330_1	47.92%	144	6e-38	MCA_06330_1
A0A0J9X2R7_GEOCN	50.00%	138	1e-37	Similar to Saccharomyces cerevisiae YPR020W ATP20 Subunit g of the mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA01s05356g PE=4 SV=1
UniRef50_A0A0J9X2R7	50.00%	138	2e-34	Similar to Saccharomyces cerevisiae YPR020W ATP20 Subunit g of the mitochondrial F1F0 ATP synthase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2R7_GEOCN
B5FVB8_YARLI	49.50%	101	5e-30	YALI0B21527p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B21527g PE=4 SV=1
A0A167E9J9_9ASCO	46.73%	107	5e-29	F1F0 ATP synthase subunit g OS=Sugiyamaella lignohabitans GN=ATP20 PE=4 SV=1
A0A060T9Q7_BLAAD	38.30%	141	8e-26	ARAD1D20548p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D20548g PE=4 SV=1
ATPN_YEAST	41.12%	107	3e-24	ATP synthase subunit g, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP20 PE=1 SV=1
A0A1E3PJI7_9ASCO	43.30%	97	5e-22	ATP synthase G chain, mitochondrial (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_24772 PE=4 SV=1
Q59M30_CANAL	41.07%	112	1e-20	F1F0 ATP synthase subunit g OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP20 PE=4 SV=1

Probability of mitochondrial location: 0.9811
Predicted cleavage: 25

None predicted.

>MIA_03313_1
MLRPQTLLRASKAATMAPRVGVRNASSLSSIPAKAAGLVNCTVFWAKVVGELAKQVYIKEGLAPPTQAQVKSVFELLKKS
ALEAASRPSAFIESLSQVNKAQVAVKGTIAFVQILGLFSLGEIVGRRHVVGYKHY

GO:0015986 ATP synthesis coupled proton transport

GO:0015078 hydrogen ion transmembrane transporter activity

GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)

Filter view on