Protein
MIA_03313_1
Length
135 amino acids
Browser: contig04:843379-843787+
Protein function
| EGGNOG: | 0PRGV | ATP20 | subunit g |
|---|---|---|---|
| SGD closest match: | S000006224 | ATP20 | ATP synthase subunit g, mitochondrial |
| CGD closest match: | CAL0000179249 | ATP20 | F1F0 ATP synthase subunit g |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_06330_1 | 47.92% | 144 | 6e-38 | MCA_06330_1 |
| A0A0J9X2R7_GEOCN | 50.00% | 138 | 1e-37 | Similar to Saccharomyces cerevisiae YPR020W ATP20 Subunit g of the mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA01s05356g PE=4 SV=1 |
| UniRef50_A0A0J9X2R7 | 50.00% | 138 | 2e-34 | Similar to Saccharomyces cerevisiae YPR020W ATP20 Subunit g of the mitochondrial F1F0 ATP synthase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2R7_GEOCN |
| B5FVB8_YARLI | 49.50% | 101 | 5e-30 | YALI0B21527p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B21527g PE=4 SV=1 |
| A0A167E9J9_9ASCO | 46.73% | 107 | 5e-29 | F1F0 ATP synthase subunit g OS=Sugiyamaella lignohabitans GN=ATP20 PE=4 SV=1 |
| A0A060T9Q7_BLAAD | 38.30% | 141 | 8e-26 | ARAD1D20548p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D20548g PE=4 SV=1 |
| ATPN_YEAST | 41.12% | 107 | 3e-24 | ATP synthase subunit g, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP20 PE=1 SV=1 |
| A0A1E3PJI7_9ASCO | 43.30% | 97 | 5e-22 | ATP synthase G chain, mitochondrial (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_24772 PE=4 SV=1 |
| Q59M30_CANAL | 41.07% | 112 | 1e-20 | F1F0 ATP synthase subunit g OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP20 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9811
Predicted cleavage: 25
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_03313_1 MLRPQTLLRASKAATMAPRVGVRNASSLSSIPAKAAGLVNCTVFWAKVVGELAKQVYIKEGLAPPTQAQVKSVFELLKKS ALEAASRPSAFIESLSQVNKAQVAVKGTIAFVQILGLFSLGEIVGRRHVVGYKHY
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)