Protein
MCA_06330_1
Length
142 amino acids
Gene name: ATP20
Description: ATP synthase subunit g, mitochondrial
Browser: contigD:3873338-3873767+
RNA-seq: read pairs 15758, FPKM 1361.6, percentile rank 97.1% (100% = highest expression)
Protein function
| Annotation: | ATP20 | ATP synthase subunit g, mitochondrial | |
|---|---|---|---|
| KEGG: | K02140 | ATPeFG | F-type H+-transporting ATPase subunit g |
| EGGNOG: | 0PRGV | ATP20 | subunit g |
| SGD closest match: | S000006224 | ATP20 | ATP synthase subunit g, mitochondrial |
| CGD closest match: | CAL0000179249 | ATP20 | F1F0 ATP synthase subunit g |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X2R7_GEOCN | 56.04% | 91 | 1e-32 | Similar to Saccharomyces cerevisiae YPR020W ATP20 Subunit g of the mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA01s05356g PE=4 SV=1 |
| UniRef50_A0A0J9X2R7 | 56.04% | 91 | 2e-29 | Similar to Saccharomyces cerevisiae YPR020W ATP20 Subunit g of the mitochondrial F1F0 ATP synthase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2R7_GEOCN |
| MIA_03313_1 | 59.78% | 92 | 1e-31 | MIA_03313_1 |
| B5FVB8_YARLI | 46.07% | 89 | 1e-24 | YALI0B21527p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B21527g PE=4 SV=1 |
| ATPN_YEAST | 41.76% | 91 | 8e-21 | ATP synthase subunit g, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP20 PE=1 SV=1 |
| A0A167E9J9_9ASCO | 45.65% | 92 | 3e-20 | F1F0 ATP synthase subunit g OS=Sugiyamaella lignohabitans GN=ATP20 PE=4 SV=1 |
| A0A060T9Q7_BLAAD | 40.00% | 95 | 3e-19 | ARAD1D20548p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D20548g PE=4 SV=1 |
| A0A1E3PJI7_9ASCO | 38.89% | 90 | 2e-16 | ATP synthase G chain, mitochondrial (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_24772 PE=4 SV=1 |
| Q59M30_CANAL | 38.20% | 89 | 1e-11 | F1F0 ATP synthase subunit g OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP20 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9959
Predicted cleavage: 28
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_06330_1 MYRSQLIRSTKSVAQYSRVIARSNSTSAVSKATNAVSSVTSTVSNIISKTVFWAKVVGELGKQVYIKEGMAPPTSAQLKS VAELLQSQAKTAFTQPEKIVNTLKEKPLEYSVKFGIAAVQVFGLFSLGEIIGRRHVIGYKKH
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0015078 hydrogen ion transmembrane transporter activity
Cellular Component
GO:0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)