Protein
MIA_03310_1
Length
255 amino acids
Browser: contig04:839378-840146+
Protein function
EGGNOG: | 0PN2P | FG05508.1 | Cwf15 Cwc15 cell cycle control family protein |
---|
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X828_GEOCN | 47.500% | 120 | 7.76e-20 | Similar to Saccharomyces cerevisiae YDR163W CWC15 Non-essential protein involved in pre-mRNA splicing OS=Geotrichum candidum GN=BN980_GECA04s02056g PE=4 SV=1 |
UniRef50_A0A0J9X828 | 47.500% | 120 | 1.59e-16 | Similar to Saccharomyces cerevisiae YDR163W CWC15 Non-essential protein involved in pre-mRNA splicing n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X828_GEOCN |
A0A167E9P0_9ASCO | 50.000% | 88 | 8.20e-18 | Complexed with Cdc5 protein Cwf15 OS=Sugiyamaella lignohabitans GN=cwf15 PE=4 SV=1 |
MCA_06327_1 | 56.923% | 65 | 2.86e-17 | MCA_06327_1 |
A0A060T2D0_BLAAD | 75.000% | 44 | 2.37e-17 | ARAD1A07370p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07370g PE=4 SV=1 |
A0A1E3PJT6_9ASCO | 51.471% | 68 | 9.43e-14 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82602 PE=4 SV=1 |
CWC15_YARLI | 76.923% | 39 | 1.15e-12 | Pre-mRNA-splicing factor CWC15 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC15 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3995
Predicted cleavage: 40
Protein family membership
- Pre-mRNA-splicing factor Cwf15/Cwc15 (IPR006973)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04889 (Cwf_Cwc_15)
-

Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_03310_1 MTTAHRPTFDPAKGKSSQTTGSILHKRFLPSHTKLKVRGKGQGGLADRYENGEPQEVDERERLRAALLAKEESSGRVTKR KTLVLHEESSVDEEENDKGEEQGLVKRRRVLEVDPEDREDDDDGGDSGESGKEEESDDDEEEEDGEDSDEDEDDSEDEAE ELRRELRKIEAERAERAKAEEEAAREREIAEGNPLLRTGSNSGTVTVRRRWYNEGVFADQARGLAVRPEDAPKYGFVNDA LRSDFHRKFMDKYIR
GO term prediction
Biological Process
GO:0000398 mRNA splicing, via spliceosome
Molecular Function
None predicted.
Cellular Component
GO:0005681 spliceosomal complex