Protein
MCA_06327_1
Length
274 amino acids
Gene name: CWC15
Description: Pre-mRNA-splicing factor CWC15
Browser: contigD:3869467-3870292+
RNA-seq: read pairs 610, FPKM 27.4, percentile rank 50.2% (100% = highest expression)
Protein function
| Annotation: | CWC15 | Pre-mRNA-splicing factor CWC15 | |
|---|---|---|---|
| KEGG: | K12863 | CWC15 | protein CWC15 |
| EGGNOG: | 0PN2P | FG05508.1 | Cwf15 Cwc15 cell cycle control family protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| UniRef50_A0A1R0H3B7 | 58.21% | 67 | 3e-17 | Protein CWC15-like protein n=1 Tax=Smittium mucronatum TaxID=133383 RepID=A0A1R0H3B7_9FUNG |
| MIA_03310_1 | 56.92% | 65 | 5e-17 | MIA_03310_1 |
| A0A0J9X828_GEOCN | 52.11% | 71 | 1e-15 | Similar to Saccharomyces cerevisiae YDR163W CWC15 Non-essential protein involved in pre-mRNA splicing OS=Geotrichum candidum GN=BN980_GECA04s02056g PE=4 SV=1 |
| A0A060T2D0_BLAAD | 75.68% | 37 | 2e-14 | ARAD1A07370p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07370g PE=4 SV=1 |
| CWC15_YARLI | 43.28% | 67 | 8e-14 | Pre-mRNA-splicing factor CWC15 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC15 PE=3 SV=1 |
| A0A1E3PJT6_9ASCO | 52.05% | 73 | 1e-13 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82602 PE=4 SV=1 |
| A0A167E9P0_9ASCO | 47.14% | 70 | 3e-12 | Complexed with Cdc5 protein Cwf15 OS=Sugiyamaella lignohabitans GN=cwf15 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1657
Predicted cleavage: 42
Protein family membership
- Pre-mRNA-splicing factor Cwf15/Cwc15 (IPR006973)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF04889 (Cwf_Cwc_15)
-
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_06327_1 MTTAHRPTFDPAKGKSTQSSASITHARALPAYTKIKYRQRGQGGIGGLRVDQLREKDYDEYSGKNLDARERFKNDLLDRE RATSKRSSNSLAYISDSEQDKESRSNLIKQESEEGKNEADDLISRSKLAILNPEDADSDDDVDNNNNESSSDENSDSSDN DEAESGDEDNSDDEDDEDEEALLRLELEKIERERAERQTEEQKARRLEEISHGNPLLNKNKDSGFKRRWNDDVVFQNQAR GVPVRPEEANANREFINDSLRSDFHRRFMKKYIR
GO term prediction
Biological Process
GO:0000398 mRNA splicing, via spliceosome
Molecular Function
None predicted.
Cellular Component
GO:0005681 spliceosomal complex