Protein
MIA_03235_1
Length
166 amino acids
Browser: contig04:628729-629489+
Protein function
| EGGNOG: | 0PN8K | ATP16 | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits |
|---|---|---|---|
| SGD closest match: | S000002162 | ATP16 | ATP synthase subunit delta, mitochondrial |
| CGD closest match: | CAL0000197920 | ATP16 | F1F0 ATP synthase subunit delta |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00900_1 | 85.542% | 166 | 6.23e-104 | MCA_00900_1 |
| A0A0J9XJP2_GEOCN | 80.120% | 166 | 3.55e-89 | Similar to Saccharomyces cerevisiae YDL004W ATP16 Delta subunit of the central stalk of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA24s00725g PE=3 SV=1 |
| A0A060T751_BLAAD | 62.745% | 153 | 2.16e-65 | ARAD1B20504p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B20504g PE=3 SV=1 |
| UniRef50_G9P662 | 58.896% | 163 | 1.80e-55 | F1F0 ATP synthase delta chain mitochondrial n=56 Tax=leotiomyceta TaxID=716546 RepID=G9P662_HYPAI |
| A0A1D8PUD2_CANAL | 49.686% | 159 | 6.58e-53 | F1F0 ATP synthase subunit delta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP16 PE=3 SV=1 |
| A0A1E3PNB8_9ASCO | 62.185% | 119 | 3.39e-50 | Uncharacterized protein (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_8412 PE=4 SV=1 |
| A0A1E4TF72_9ASCO | 50.000% | 152 | 7.34e-49 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_24048 PE=3 SV=1 |
| ATPD_YEAST | 51.656% | 151 | 5.36e-46 | ATP synthase subunit delta, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP16 PE=1 SV=1 |
| Q6C877_YARLI | 63.636% | 121 | 6.28e-46 | YALI0D22022p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D22022g PE=1 SV=1 |
| A0A167FYE5_9ASCO | 72.603% | 73 | 8.05e-35 | F1F0 ATP synthase subunit delta OS=Sugiyamaella lignohabitans GN=ATP16 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9922
Predicted cleavage: 36
Protein family membership
- ATP synthase, F1 complex, delta/epsilon subunit (IPR001469)
Domains and repeats
-
Domain
1
20
40
60
80
100
120
140
166
Detailed signature matches
no IPR
Unintegrated signatures
Residue annotation
-
gamma subunit inte...
-
epsilon subunit in...
-
LBP interface cd12...
Protein sequence
>MIA_03235_1 MMYLARSVARKALPAMARPSMFVARRGFAEAVPADKLRLSLALPHETLYENTDVVQVNIPSTAGDLGILADHVPTIQQLR PGLVEIIESGGKSTQFFVSGGFATVSEGSKIAVNVVEAYAPEDFSSEAVKSLTAEAQKNATSSDEAVSTEAKIQLEVLES LAYYVK
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
Molecular Function
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Cellular Component
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)