Protein

MIA_03231_1

Length
426 amino acids

Browser: contig04:621071-622434+

Protein function

EGGNOG:0PICCRPT226S protease regulatory subunit
SGD closest match:S000002165RPT226S proteasome regulatory subunit 4 homolog
CGD closest match:CAL0000181835RPT2Proteasome regulatory particle base subunit

Protein alignments

%idAln lengthE-value
MCA_00896_196.87%4150.0MCA_00896_1
A0A0J9X9S2_GEOCN93.98%4150.0Similar to Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases of the 19S regulatory particle of the 26S proteasome OS=Geotrichum candidum GN=BN980_GECA06s02298g PE=3 SV=1
A0A060TDL6_BLAAD90.89%4170.0ARAD1D08008p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D08008g PE=3 SV=1
Q6C352_YARLI90.12%4150.0YALI0F02585p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F02585g PE=3 SV=1
A0A1E3PH34_9ASCO89.23%4180.026S proteasome subunit P45 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83619 PE=3 SV=1
A0A1E4TEX0_9ASCO86.99%4150.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_56814 PE=3 SV=1
A0A167FYH3_9ASCO94.41%3760.0Proteasome regulatory particle base subunit RPT2 OS=Sugiyamaella lignohabitans GN=RPT2 PE=3 SV=1
A0A1D8PIV7_CANAL87.22%3990.0Proteasome regulatory particle base subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPT2 PE=3 SV=1
PRS4_YEAST81.28%4220.026S proteasome regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3
UniRef50_P3661279.95%4190.026S proteasome regulatory subunit 4 homolog n=348 Tax=Eukaryota TaxID=2759 RepID=PRS4_SCHPO

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0174

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 426

Detailed signature matches

  1. Family IPR005937
    26S proteasome regulatory subunit P45-like
    1. TIGR01242
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR003593
    AAA+ ATPase domain
    1. SM00382 (AAA_5)
  4. Domain IPR003959
    ATPase, AAA-type, core
    1. PF00004 (AAA)
  5. SITE IPR003960
    ATPase, AAA-type, conserved site
    1. PS00674 (AAA)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.8.60
  2. G3DSA:3.40.50...
  3. cd00009 (AAA)
  4. mobidb-lite (disord...)

Residue annotation

  1. Walker A motif cd0...
  2. ATP binding site c...
  3. Walker B motif cd0...
  4. arginine finger cd...

Protein sequence

>MIA_03231_1
MDFLAKDEKPKYEPPVSTRTHRKKKKKGPDSAAKLPAVYPTTRSKLKLLKMERIKDHLLLEEEFVQNQERLKPTDDKIAE
ERGKVDEMRGSPMSVGTLEEIIDDDHAIVSTSSGPEYYVSIRSFVDKDLLEPGTSVLLHHKSVSIVGVLQDDTDPMVSVM
KLDKAPTESYADIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSE
LIQKYLGDGPRLTRQIFQIAAEHAPSIVFIDEIDAIGTKRYESTSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKI
ESLDPALIRPGRIDRKILFENPDPATKRKILQIHTSKMSLAQDVDLEELVSAKDDLSGADIKAICTEAGLLALRERRMKV
TMEDFRSARERVLKNKIEENLEGLYL

GO term prediction

Biological Process

GO:0030163 protein catabolic process

Molecular Function

GO:0005524 ATP binding
GO:0016787 hydrolase activity

Cellular Component

GO:0005737 cytoplasm