Protein

MCA_00896_1

Length
441 amino acids

Gene name: RPT2

Description: 26S proteasome regulatory subunit 4 homolog; ATPase of the 19S regulatory particle of the 26S proteasome

Browser: contigA:2825151-2826617+

RNA-seq: read pairs 5234, FPKM 146.3, percentile rank 84.6% (100% = highest expression)

Protein function

Annotation:RPT226S proteasome regulatory subunit 4 homolog; ATPase of the 19S regulatory particle of the 26S proteasome
KEGG:K03062PSMC1 26S proteasome regulatory subunit T2
EGGNOG:0PICCRPT226S protease regulatory subunit
SGD closest match:S000002165RPT226S proteasome regulatory subunit 4 homolog
CGD closest match:CAL0000181835RPT2Proteasome regulatory particle base subunit

Protein alignments

%idAln lengthE-value
MIA_03231_196.84%4110.0MIA_03231_1
A0A0J9X9S2_GEOCN92.21%4110.0Similar to Saccharomyces cerevisiae YDL007W RPT2 One of six ATPases of the 19S regulatory particle of the 26S proteasome OS=Geotrichum candidum GN=BN980_GECA06s02298g PE=3 SV=1
A0A060TDL6_BLAAD89.29%4110.0ARAD1D08008p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D08008g PE=3 SV=1
Q6C352_YARLI89.05%4110.0YALI0F02585p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F02585g PE=3 SV=1
A0A1E3PH34_9ASCO86.20%4420.026S proteasome subunit P45 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83619 PE=3 SV=1
A0A167FYH3_9ASCO93.88%3760.0Proteasome regulatory particle base subunit RPT2 OS=Sugiyamaella lignohabitans GN=RPT2 PE=3 SV=1
A0A1E4TEX0_9ASCO86.97%3990.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_56814 PE=3 SV=1
A0A1D8PIV7_CANAL82.77%4410.0Proteasome regulatory particle base subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPT2 PE=3 SV=1
UniRef50_A0A168CLK479.18%4130.01,3-beta-glucanosyltransferase n=1 Tax=Isaria fumosorosea ARSEF 2679 TaxID=1081104 RepID=A0A168CLK4_9HYPO
PRS4_YEAST81.02%4110.026S proteasome regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0177

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 441

Detailed signature matches

  1. Family IPR005937
    26S proteasome regulatory subunit P45-like
    1. TIGR01242
  2. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  3. Domain IPR003593
    AAA+ ATPase domain
    1. SM00382 (AAA_5)
  4. Domain IPR003959
    ATPase, AAA-type, core
    1. PF00004 (AAA)
  5. SITE IPR003960
    ATPase, AAA-type, conserved site
    1. PS00674 (AAA)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.8.60
  2. G3DSA:3.40.50...
  3. cd00009 (AAA)
  4. mobidb-lite (disord...)

Residue annotation

  1. Walker A motif cd0...
  2. ATP binding site c...
  3. Walker B motif cd0...
  4. arginine finger cd...

Protein sequence

>MCA_00896_1
MVSGQGPSGLPGDRSNQKKKKDEKPKYEPPVSSRTHRKKKKKGPDSAAKLPAVYPTTRSKLKLLKMERIKDHLLLEEEFV
QNQERLKPTDDKIAEERRKVDEMRGTPMSVGNLEEIIDDDHAIVSASSGPEYYVSIRSFVDKDLLEPGTSVLLHQKSISV
VGVLQDDTDPMVSVMKLDKAPTESYADIGGLESQIQEIKEAVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAV
ANQTSATFLRIVGSELIQKYLGDGPRLTRQIFQIAAEHAPSIVFIDEIDAIGTKRYESTSGGEREIQRTMLELLNQLDGF
DDRGDVKVIMATNKIESLDPALIRPGRIDRKILFENPDPATKRKILSIHTSKMSLADDVNLEEFVSAKDDLSGADIKAIC
TEAGLLALRERRMKVTMEDFRSARERVLKNKIEENLEGLYL

GO term prediction

Biological Process

GO:0030163 protein catabolic process

Molecular Function

GO:0005524 ATP binding
GO:0016787 hydrolase activity

Cellular Component

GO:0005737 cytoplasm