Protein

MIA_03183_1

Length
275 amino acids


Browser: contig04:487689-488517+

Protein function

EGGNOG:0PRXZPGUG_02834mitochondrial 54S ribosomal protein YmL41
SGD closest match:S000002813MRP2054S ribosomal protein L41, mitochondrial
CGD closest match:CAL0000174219MRP20Mitochondrial 54S ribosomal protein YmL41

Protein alignments

%idAln lengthE-value
MCA_01393_164.844%2561.71e-98MCA_01393_1
A0A0J9X2U0_GEOCN57.143%2318.51e-80Similar to Saccharomyces cerevisiae YDR405W MRP20 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA01s05444g PE=4 SV=1
UniRef50_A0A0J9X2U057.143%2311.74e-76Similar to Saccharomyces cerevisiae YDR405W MRP20 Mitochondrial ribosomal protein of the large subunit n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X2U0_GEOCN
A0A060TFC0_BLAAD49.438%2671.97e-74ARAD1D14300p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D14300g PE=4 SV=1
A0A167EB71_9ASCO50.427%2347.96e-72Mitochondrial 54S ribosomal protein YmL41 OS=Sugiyamaella lignohabitans GN=MRP20 PE=4 SV=1
A0A1E3PFD4_9ASCO54.321%1624.66e-59Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47839 PE=4 SV=1
RM41_YEAST51.977%1774.19e-5754S ribosomal protein L41, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP20 PE=1 SV=1
A0A1D8PCJ1_CANAL48.667%1501.59e-46Mitochondrial 54S ribosomal protein YmL41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRP20 PE=4 SV=1
Q6C653_YARLI45.570%1586.89e-44YALI0E12353p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E12353g PE=4 SV=1
A0A1E4TC56_9ASCO45.794%1075.04e-25Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3973 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9978
Predicted cleavage: 13

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 275

Detailed signature matches

    1. PF00276 (Ribosomal_L23)
    1. SSF54189 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_03183_1
MPRLMIRSAKRKAVAHPPPIFFPKVPLSQQIKQKEEAKLASKDSPVKTPLPPTKPKKKFAAGTRAPPKANRASQGLARAR
EAIEKGEPHFHVGTKQIYFPTAKVVLLRPNAKHTPFQAKFAVPRYFNKLDLRDYLYHVYGLRALNVTTQLLWARWTRDTP
RSSRYRTSQIKKMTIDMIDPFVWPEEPSEKARNKMFNLENVNEMRKYFEDASQRFGADRNKEPTAFGGIVGPFPDPPQPF
IPKYLKKYAQREKARAEYLTQKAEEEELVKKFLKL

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome