Protein

MCA_01393_1

Length
275 amino acids


Gene name: MRP20

Description: 54S ribosomal protein L41, mitochondrial

Browser: contigA:4349679-4350507+

RNA-seq: read pairs 4264, FPKM 190.9, percentile rank 87.6% (100% = highest expression)

Protein function

Annotation:MRP2054S ribosomal protein L41, mitochondrial
KEGG:K02892RP-L23 large subunit ribosomal protein L23
EGGNOG:0PRXZPGUG_02834mitochondrial 54S ribosomal protein YmL41
SGD closest match:S000002813MRP2054S ribosomal protein L41, mitochondrial
CGD closest match:CAL0000174219MRP20Mitochondrial 54S ribosomal protein YmL41

Protein alignments

%idAln lengthE-value
MIA_03183_163.04%2765e-101MIA_03183_1
A0A0J9X2U0_GEOCN54.32%2783e-84Similar to Saccharomyces cerevisiae YDR405W MRP20 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA01s05444g PE=4 SV=1
UniRef50_A0A0J9X2U054.32%2787e-81Similar to Saccharomyces cerevisiae YDR405W MRP20 Mitochondrial ribosomal protein of the large subunit n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X2U0_GEOCN
A0A167EB71_9ASCO47.83%2765e-71Mitochondrial 54S ribosomal protein YmL41 OS=Sugiyamaella lignohabitans GN=MRP20 PE=4 SV=1
A0A060TFC0_BLAAD50.22%2312e-67ARAD1D14300p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D14300g PE=4 SV=1
A0A1E3PFD4_9ASCO59.15%1425e-53Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47839 PE=4 SV=1
RM41_YEAST52.94%1531e-5054S ribosomal protein L41, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP20 PE=1 SV=1
A0A1D8PCJ1_CANAL55.37%1217e-46Mitochondrial 54S ribosomal protein YmL41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MRP20 PE=4 SV=1
Q6C653_YARLI43.93%1733e-42YALI0E12353p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E12353g PE=4 SV=1
A0A1E4TC56_9ASCO51.52%992e-25Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3973 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9992
Predicted cleavage: 18

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 275

Detailed signature matches

    1. PF00276 (Ribosomal_L23)
    1. SSF54189 (Ribosomal...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_01393_1
MARLLFRSAKRKAVARPPPVFIPKTSLLEQARLKEQAQTTDKKVKASAPPPPPKRTPVKFKQGELPTPRPNRATQNLERV
RKAIENDEPHFRVGERQVYLPMAKVVLLRPNAKHTPYQAKFAVPKYFNKLDLRDYLYHVYGLRALNITTQLSFTRWTRDT
IRSPRYRTTQIKKMTIDMIDPFVWPKQPSASEMAKMLNLELRLELEKYIDDSRRLGSDKNKEPTSFGGILGPFPAPPQPF
VPKYVKKNALRIKEKDARLAARAEDEALVKKYLNL

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome