Protein
MIA_03174_1
Length
130 amino acids
Browser: contig04:445748-446369-
Protein function
EGGNOG: | 0PNSS | RPS22 | 40s ribosomal protein s22 |
---|---|---|---|
SGD closest match: | S000004359 | RPS22B | 40S ribosomal protein S22-B |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_03940_1 | 87.692% | 130 | 3.74e-86 | MCA_03940_1 |
A0A1E3PDF3_9ASCO | 86.923% | 130 | 1.21e-85 | Ribosomal protein S22B OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47856 PE=3 SV=1 |
Q6CA56_YARLI | 85.385% | 130 | 2.82e-85 | YALI0D05731p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D05731g PE=3 SV=1 |
A0A060SZP7_BLAAD | 86.154% | 130 | 1.77e-84 | ARAD1C02310p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C02310g PE=3 SV=1 |
RS22B_YEAST | 84.615% | 130 | 5.78e-84 | 40S ribosomal protein S22-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS22B PE=1 SV=3 |
A0A0J9XKI0_GEOCN | 86.154% | 130 | 1.77e-83 | Similar to Saccharomyces cerevisiae YJL190C RPS22A Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA24s01176g PE=3 SV=1 |
UniRef50_P0C0W1 | 83.846% | 130 | 3.67e-80 | 40S ribosomal protein S22-A n=183 Tax=Eukaryota TaxID=2759 RepID=RS22A_YEAST |
RS22B_CANAL | 83.846% | 130 | 5.06e-83 | 40S ribosomal protein S22-B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS22B PE=3 SV=1 |
A0A1E4TIY8_9ASCO | 82.677% | 127 | 1.62e-72 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_283 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3730
Protein family membership
- Ribosomal protein S8 (IPR000630)
Domains and repeats
None predicted.
Detailed signature matches
-
-
MF_01302_A (Ribosom...)
-
PS00053 (RIBOSOMAL_S8)
-
SSF56047 (Ribosomal...)
-
PF00410 (Ribosomal_S8)
-

Unintegrated signatures
Protein sequence
>MIA_03174_1 MTRTSVLADALTTINNAEKAGKRQALLRPSSKVIIKFLEVMQKHGYIGEFEYVDDHRAGKIVVQLNGRLNKAGVISPRFN VRIDEIEQWVTNMLPARQFGYIILTTSAGIMDHEEARRKHVAGKILGYFY
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005840 ribosome