Protein
MIA_03157_1
Length
153 amino acids
Browser: contig04:388938-389400+
Protein function
| EGGNOG: | 0PNPD | COX5A | cytochrome C oxidase |
|---|---|---|---|
| SGD closest match: | S000004997 | COX5A | Cytochrome c oxidase polypeptide 5A, mitochondrial |
| CGD closest match: | CAL0000179426 | COX5 | Cytochrome c oxidase subunit Va |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05224_2 | 72.667% | 150 | 1.96e-62 | MCA_05224_2 |
| A0A0J9XJZ3_GEOCN | 67.460% | 126 | 4.10e-53 | Similar to Saccharomyces cerevisiae YNL052W COX5A Subunit Va of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain OS=Geotrichum candidum GN=BN980_GECA20s01330g PE=4 SV=1 |
| A0A060TI40_BLAAD | 52.667% | 150 | 5.10e-41 | ARAD1D35992p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D35992g PE=4 SV=1 |
| UniRef50_A0A060TI40 | 52.667% | 150 | 1.26e-37 | ARAD1D35992p n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A060TI40_BLAAD |
| A0A167ECI6_9ASCO | 56.349% | 126 | 5.75e-41 | Cytochrome c oxidase subunit Va OS=Sugiyamaella lignohabitans GN=COX5A PE=4 SV=1 |
| A0A1E3PHN7_9ASCO | 56.250% | 128 | 1.74e-40 | Cytochrome c oxidase subunit IV (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_11292 PE=4 SV=1 |
| Q6C309_YARLI | 49.242% | 132 | 3.68e-35 | YALI0F03567p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03567g PE=4 SV=1 |
| A0A1E4TEJ8_9ASCO | 48.413% | 126 | 6.79e-34 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_102820 PE=4 SV=1 |
| COX5A_YEAST | 50.000% | 128 | 2.45e-32 | Cytochrome c oxidase polypeptide 5A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5A PE=1 SV=1 |
| Q5APK5_CANAL | 42.520% | 127 | 3.84e-26 | Cytochrome c oxidase subunit Va OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX5 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9034
Predicted cleavage: 22
Protein family membership
- Cytochrome c oxidase subunit IV family (IPR004203)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
NON_CYTOPLASM... (N...)
-
SIGNAL_PEPTIDE (Sig...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
-
SIGNAL_PEPTID... (S...)
Protein sequence
>MIA_03157_1 MLRAIRPMPTAVRAAAGAVRAASTKAISTPAIIDLESRWEKMTADEQEDIITQLAERQKGSWTELTPLEKRAAWYISYGT WGPRKPIHPKGEVAEILKGVGLMVFFGVVLFAGARAVSEGDGITSTKEWAEASHEILKEQKANPFRGFNQVTK
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
None predicted.