Protein
MCA_05224_2
Length
152 amino acids
Gene name: COX5A
Description: Cytochrome c oxidase polypeptide 5A, mitochondrial
Browser: contigD:674884-675343+
RNA-seq: read pairs 35594, FPKM 2874.5, percentile rank 98.3% (100% = highest expression)
Protein function
Annotation: | COX5A | Cytochrome c oxidase polypeptide 5A, mitochondrial | |
---|---|---|---|
KEGG: | K02263 | COX4 | cytochrome c oxidase subunit 4 |
EGGNOG: | 0PNPD | COX5A | cytochrome C oxidase |
SGD closest match: | S000004997 | COX5A | Cytochrome c oxidase polypeptide 5A, mitochondrial |
CGD closest match: | CAL0000179426 | COX5 | Cytochrome c oxidase subunit Va |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03157_1 | 72.67% | 150 | 7e-66 | MIA_03157_1 |
A0A0J9XJZ3_GEOCN | 72.58% | 124 | 9e-63 | Similar to Saccharomyces cerevisiae YNL052W COX5A Subunit Va of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain OS=Geotrichum candidum GN=BN980_GECA20s01330g PE=4 SV=1 |
A0A060TI40_BLAAD | 62.90% | 124 | 8e-52 | ARAD1D35992p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D35992g PE=4 SV=1 |
UniRef50_A0A060TI40 | 62.90% | 124 | 2e-48 | ARAD1D35992p n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A060TI40_BLAAD |
A0A167ECI6_9ASCO | 59.68% | 124 | 2e-50 | Cytochrome c oxidase subunit Va OS=Sugiyamaella lignohabitans GN=COX5A PE=4 SV=1 |
A0A1E3PHN7_9ASCO | 57.26% | 124 | 2e-46 | Cytochrome c oxidase subunit IV (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_11292 PE=4 SV=1 |
Q6C309_YARLI | 55.12% | 127 | 6e-43 | YALI0F03567p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03567g PE=4 SV=1 |
A0A1E4TEJ8_9ASCO | 50.81% | 124 | 2e-39 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_102820 PE=4 SV=1 |
COX5A_YEAST | 49.19% | 124 | 6e-38 | Cytochrome c oxidase polypeptide 5A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5A PE=1 SV=1 |
Q5APK5_CANAL | 45.97% | 124 | 2e-33 | Cytochrome c oxidase subunit Va OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX5 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9919
Predicted cleavage: 22
Protein family membership
- Cytochrome c oxidase subunit IV family (IPR004203)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
TRANSMEMBRANE (Tran...)
Residue annotation
-
Subunit IV/VIIIb i...
-
Subunit IV/Vb inte...
-
Subunit IV/Va inte...
-
Subunit IV/I inter...
-
putative ATP/ADP b...
-
Subunit IV/II inte...
-
Subunit IV/VIIb in...
-
Subunit IV/VIc int...
Protein sequence
>MCA_05224_2 MLRSIRPMPVARAALRATTRAASTKAISTPTIIDLESRWETMPADEQEDIISQLAERQKGPWTELTPNEKRAAWYISYGT WGPRKPIHPKGEVSEIFKGVVLVIGAAGALFGAFRYFTPGPGHTFTPEWQEASNEILKENKANPFRGYDQKF
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004129 cytochrome-c oxidase activity
Cellular Component
None predicted.