Protein

MCA_05224_2

Length
152 amino acids


Gene name: COX5A

Description: Cytochrome c oxidase polypeptide 5A, mitochondrial

Browser: contigD:674884-675343+

RNA-seq: read pairs 35594, FPKM 2874.5, percentile rank 98.3% (100% = highest expression)

Protein function

Annotation:COX5ACytochrome c oxidase polypeptide 5A, mitochondrial
KEGG:K02263COX4 cytochrome c oxidase subunit 4
EGGNOG:0PNPDCOX5Acytochrome C oxidase
SGD closest match:S000004997COX5ACytochrome c oxidase polypeptide 5A, mitochondrial
CGD closest match:CAL0000179426COX5Cytochrome c oxidase subunit Va

Protein alignments

%idAln lengthE-value
MIA_03157_172.67%1507e-66MIA_03157_1
A0A0J9XJZ3_GEOCN72.58%1249e-63Similar to Saccharomyces cerevisiae YNL052W COX5A Subunit Va of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain OS=Geotrichum candidum GN=BN980_GECA20s01330g PE=4 SV=1
A0A060TI40_BLAAD62.90%1248e-52ARAD1D35992p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D35992g PE=4 SV=1
UniRef50_A0A060TI4062.90%1242e-48ARAD1D35992p n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A060TI40_BLAAD
A0A167ECI6_9ASCO59.68%1242e-50Cytochrome c oxidase subunit Va OS=Sugiyamaella lignohabitans GN=COX5A PE=4 SV=1
A0A1E3PHN7_9ASCO57.26%1242e-46Cytochrome c oxidase subunit IV (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_11292 PE=4 SV=1
Q6C309_YARLI55.12%1276e-43YALI0F03567p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03567g PE=4 SV=1
A0A1E4TEJ8_9ASCO50.81%1242e-39Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_102820 PE=4 SV=1
COX5A_YEAST49.19%1246e-38Cytochrome c oxidase polypeptide 5A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5A PE=1 SV=1
Q5APK5_CANAL45.97%1242e-33Cytochrome c oxidase subunit Va OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COX5 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9919
Predicted cleavage: 22

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. cd00922 (Cyt_c_Oxid...)
    2. SSF81406 (Mitochond...)
    3. PF02936 (COX4)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Residue annotation

  1. Subunit IV/VIIIb i...
  2. Subunit IV/Vb inte...
  3. Subunit IV/Va inte...
  4. Subunit IV/I inter...
  5. putative ATP/ADP b...
  6. Subunit IV/II inte...
  7. Subunit IV/VIIb in...
  8. Subunit IV/VIc int...

Protein sequence

>MCA_05224_2
MLRSIRPMPVARAALRATTRAASTKAISTPTIIDLESRWETMPADEQEDIISQLAERQKGPWTELTPNEKRAAWYISYGT
WGPRKPIHPKGEVSEIFKGVVLVIGAAGALFGAFRYFTPGPGHTFTPEWQEASNEILKENKANPFRGYDQKF

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0004129 cytochrome-c oxidase activity

Cellular Component

None predicted.