Protein
MIA_03130_1
Length
209 amino acids
Browser: contig04:306106-306736-
Protein function
EGGNOG: | 0PRVI | TOM22 | mitochondrial import receptor subunit tom22 |
---|---|---|---|
SGD closest match: | S000005075 | TOM22 | Mitochondrial import receptor subunit TOM22 |
CGD closest match: | CAL0000186172 | TOM22 | Tom22p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_04955_1 | 75.758% | 99 | 5.23e-40 | MCA_04955_1 |
A0A167E3R5_9ASCO | 68.367% | 98 | 1.62e-37 | Tom22p OS=Sugiyamaella lignohabitans GN=TOM22 PE=4 SV=1 |
A0A060T407_BLAAD | 65.306% | 98 | 5.65e-37 | ARAD1A13398p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A13398g PE=4 SV=1 |
A0A0J9XJ17_GEOCN | 68.750% | 96 | 6.72e-35 | Similar to Saccharomyces cerevisiae YNL131W TOM22 Component of the TOM (Translocase of outer mitochondrial membrane) complex responsible for initial import of mitochondrially directed proteins OS=Geotrichum candidum GN=BN980_GECA20s00615g PE=4 SV=1 |
UniRef50_A0A0J9XJ17 | 68.750% | 96 | 1.38e-31 | Similar to Saccharomyces cerevisiae YNL131W TOM22 Component of the TOM (Translocase of outer mitochondrial membrane) complex responsible for initial import of mitochondrially directed proteins n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJ17_GEOCN |
A0A1E3PNB0_9ASCO | 59.574% | 94 | 2.83e-30 | Mitochondrial import translocase, subunit Tom22 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68871 PE=4 SV=1 |
Q59LZ9_CANAL | 48.936% | 94 | 5.33e-22 | Tom22p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TOM22 PE=4 SV=1 |
Q6CCA8_YARLI | 50.575% | 87 | 1.14e-20 | YALI0C11011p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C11011g PE=4 SV=1 |
TOM22_YEAST | 49.438% | 89 | 1.44e-12 | Mitochondrial import receptor subunit TOM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM22 PE=1 SV=3 |
A0A1E4TJ63_9ASCO | 31.818% | 66 | 9.86e-07 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15295 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0285
Protein family membership
- Mitochondrial import receptor subunit Tom22 (IPR005683)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_03130_1 MVELTLVDDDKAKELFEQAEHDAEVSAVAAEIVEEALEEALEEAVEEAIEEIAAEEAAAEENDDDFEDTDGESETEKLTP RKASVEDVDEDDDDEDDDEDDDDYEEEVLNETLAERIVALKAVVPPAYRNVVGSVTSGVQSVVSTTFSFTTKALWVVTTS ALLLGVPLTLSVISEQQLIEMEKEMRLTQSTNEVLAPGAESGFQQAPVA
GO term prediction
Biological Process
GO:0006886 intracellular protein transport
Molecular Function
None predicted.
Cellular Component
GO:0005741 mitochondrial outer membrane