Protein
MCA_04955_1
Length
190 amino acids
Gene name: TOM22
Description: Mitochondrial import receptor subunit TOM22
Browser: contigC:4512550-4513123+
RNA-seq: read pairs 8126, FPKM 525.7, percentile rank 94.4% (100% = highest expression)
Protein function
Annotation: | TOM22 | Mitochondrial import receptor subunit TOM22 | |
---|---|---|---|
KEGG: | K17769 | TOM22 | mitochondrial import receptor subunit TOM22 |
EGGNOG: | 0PRVI | TOM22 | mitochondrial import receptor subunit tom22 |
CGD closest match: | CAL0000186172 | TOM22 | Tom22p |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_03130_1 | 75.76% | 99 | 6e-28 | MIA_03130_1 |
A0A0J9XJ17_GEOCN | 68.00% | 100 | 5e-23 | Similar to Saccharomyces cerevisiae YNL131W TOM22 Component of the TOM (Translocase of outer mitochondrial membrane) complex responsible for initial import of mitochondrially directed proteins OS=Geotrichum candidum GN=BN980_GECA20s00615g PE=4 SV=1 |
UniRef50_A0A0J9XJ17 | 68.00% | 100 | 1e-19 | Similar to Saccharomyces cerevisiae YNL131W TOM22 Component of the TOM (Translocase of outer mitochondrial membrane) complex responsible for initial import of mitochondrially directed proteins n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XJ17_GEOCN |
A0A167E3R5_9ASCO | 66.34% | 101 | 6e-23 | Tom22p OS=Sugiyamaella lignohabitans GN=TOM22 PE=4 SV=1 |
A0A060T407_BLAAD | 60.40% | 101 | 8e-23 | ARAD1A13398p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A13398g PE=4 SV=1 |
A0A1E3PNB0_9ASCO | 57.29% | 96 | 5e-21 | Mitochondrial import translocase, subunit Tom22 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68871 PE=4 SV=1 |
Q59LZ9_CANAL | 48.94% | 94 | 3e-14 | Tom22p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TOM22 PE=4 SV=1 |
Q6CCA8_YARLI | 52.87% | 87 | 2e-12 | YALI0C11011p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C11011g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0135
Protein family membership
- Mitochondrial import receptor subunit Tom22 (IPR005683)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_04955_1 MVEVSVVSEIEEKEILDNEPEVVVPKPVDPATTEEKDEDYSDVNSSDEESEEKKISTKNVGSDADDDEEEDDSSDDDEDE YDDEEDILNETIGDRIIALKAIVPPKYRYQAQEVGSSVASVVKSVFSFSSSALWVITTSSLLLGVPLTLSVISEQQLMEM EKEMKLTQSTNEVLAPGAESGFQQAPAVAV
GO term prediction
Biological Process
GO:0006886 intracellular protein transport
Molecular Function
None predicted.
Cellular Component
GO:0005741 mitochondrial outer membrane